(data stored in ACNUC7421 zone)

EMBL: CP001791.PE212

CP001791.PE212       Location/Qualifiers
FT   CDS_pept        234185..234595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97764"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97764.1"
FT                   /translation="MELLFFLVIGVVYYYNHKKIHNYFQREQLFNNEANNLQECATNSV
FT                   VMSKIYENSSAPYFMIKDKNVADFNHDLFTEFHNASQLFHHDQEFQKEMNDSHNPYVNP
FT                   GQDIIVDESYHGIDHGIGIANPSDHHDHNNHN"
     atggagttac ttttttttct agtaattggt gttgtgtatt attataatca taaaaagatt        60
     cacaattact ttcaaaggga gcaattgttt aataacgaag cgaataatct gcaggaatgt       120
     gctaccaatt cggtcgtaat gagcaaaata tatgagaaca gttctgctcc ttattttatg       180
     attaaagata aaaatgtggc agattttaac catgatttat ttacagagtt tcataatgcg       240
     tctcagttat ttcatcacga tcaagagttt caaaaggaaa tgaacgattc acataacccg       300
     tatgtaaatc cgggtcaaga tataattgtg gatgaaagct atcatggaat cgatcatggc       360
     atagggatag cgaatcctag cgatcatcac gatcataata atcataactg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page