(data stored in ACNUC7421 zone)

EMBL: CP001791.PE216

CP001791.PE216       Location/Qualifiers
FT   CDS_pept        complement(238717..238938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97768"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97768.1"
FT                   /translation="MLLVIDNIHVTLKGLIEDLKFDMKYWNDFDKIAVVSDKTSVEIVM
FT                   RLSSVLPKLDMKHFTLSKVTDATSWLNE"
     atgctgctgg tgatcgacaa catccatgtg acgctcaaag gactgatcga agacttgaag        60
     tttgatatga agtactggaa cgactttgat aaaatcgccg tcgtgagcga taagacatct       120
     gttgaaatcg tcatgcgact gagcagtgta ttgccaaagc tcgatatgaa gcacttcact       180
     ctatcgaaag tgacggacgc gacaagctgg ttaaacgagt aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page