(data stored in ACNUC7421 zone)

EMBL: CP001791.PE217

CP001791.PE217       Location/Qualifiers
FT   CDS_pept        complement(239117..239515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97769"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97769.1"
FT                   /translation="MGIYLTEEEDQCVHHGIILDLLKALIEKDQKSFQDRVWAEEMEMV
FT                   FVALNGVVAKKMRENNAQLRSLKVRYTFTGNESEQFANYMVYYRGYEEKKNYFIPHLND
FT                   LVNRTYRKLFTRYVMRPVEDQCQRQPSN"
     atgggcatct acttaacaga agaggaagat cagtgtgtac accatggcat cattttggat        60
     ttgctgaaag cgttaatcga aaaagaccag aaatcatttc aagaccgcgt gtgggcggaa       120
     gaaatggaga tggtctttgt ggcgctgaat ggcgtcgtcg caaagaaaat gcgtgaaaac       180
     aacgcacagc tgagatcact gaaggtccga tacacattca ccggaaacga atcggagcaa       240
     ttcgcaaatt atatggtcta ttacagaggc tacgaagaga agaagaatta ttttatccct       300
     cacttaaatg acctggttaa tcggacctac cggaaattgt tcacccggta cgtcatgcgg       360
     cccgttgagg atcagtgcca gcgtcaaccg tcaaactga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page