(data stored in ACNUC7421 zone)

EMBL: CP001791.PE22

CP001791.PE22        Location/Qualifiers
FT   CDS_pept        31959..33761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0023"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: AAA ATPase; TIGRFAM: DNA polymerase III,
FT                   subunits gamma and tau; KEGG: gbm:Gbem_0212 DNA polymerase
FT                   III, subunits gamma and tau; PFAM: AAA ATPase central
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97574"
FT                   /db_xref="GOA:D6XV16"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV16"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADH97574.1"
FT                   /translation="MAYQALYRVWRPQVLKDVVGQEHITRTLRNALLQQKLSHAYLFSG
FT                   PRGTGKTSAAKIIAKAVNCEQAPVEEPCNTCSTCTGIQDGSIVDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSGASYKVYIIDEVHMLTTGAFNALLKTLEEPPRHVIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITAHTMIKRMEEIIEDGDLAVDPDALSMIARASEGGMRDALSLLD
FT                   QAISYADTSVTLDDVLSIIGAASQDLMYDVMEALLDQQVADGLTAIDRLMSDGKDPGRF
FT                   MEDFIFLTRDLLMVQAAPALDESGDRKLGDQRFEILASKASQSWLFALMEKLNHFQQQM
FT                   KWASHPAVFLEMFVVQACQMPSREPEKAGLPEEVRQQISTLEHKLADLERRLQQAPSQA
FT                   PAGRPDQPASPSQPQAPVRKQPQAASTGASRANMQRVKGVLNEATKAHLKAIHQKWAQI
FT                   QDTVKQQNVAASAWLNDCKPVVASSGHYVLAFRNEMHRGMVDDKFRDLIEGVVSQVMDT
FT                   QLVMYTLLEQDWEEVKAAFVKEQKKKQASQPADGNQESEDVPQDGDSEAAGQAVEDEPE
FT                   EDQGEAVVDEAIKMFGSDLVRIEE"
     atggcttatc aggcattata cagagtatgg cgaccacagg tattgaaaga tgtcgtcggt        60
     caggaacata tcacccgtac gctccggaat gcgcttttgc agcagaaact ttcccatgcg       120
     tatctgttca gcggacctcg cggaacaggg aaaaccagtg cggcgaagat cattgccaag       180
     gcggtaaact gtgaacaggc accggtcgaa gaaccgtgta atacctgttc gacctgtacg       240
     ggcatccagg acggcagtat cgtcgatgtc attgaaattg acgcggcgag taacaacggt       300
     gtggatgaga ttcgtgatat tcgggataaa gtgaagttcg ctccgagtgg tgcatcatac       360
     aaagtctata ttattgacga ggtgcatatg ctgacgacag gagcatttaa tgccctgttg       420
     aaaacacttg aggaaccgcc gcggcatgtg atttttatcc ttgccacaac agagccgcat       480
     aaaataccgc tcaccatcat ttccagatgc cagagatttg acttcaagcg gatcactgca       540
     cataccatga tcaaacgcat ggaggagatc attgaagatg gggacctcgc cgtggatcca       600
     gacgccttgt ccatgatcgc acgggcttca gaaggcggga tgcgggatgc actcagcctg       660
     cttgatcagg cgatctctta tgcggataca tccgtcaccc tggatgatgt tttatccatc       720
     atcggtgcgg cctcgcagga tttgatgtat gatgtaatgg aagcgctcct cgatcagcag       780
     gtggcagatg gtctgactgc cattgatcgg ctgatgagcg acgggaagga tcccgggcgg       840
     tttatggaag acttcatctt tttgacccgg gatcttttaa tggtacaggc tgcacctgcc       900
     cttgatgaat ccggcgaccg taaacttggc gatcagcggt ttgagatact tgcatcaaaa       960
     gcaagccagt cgtggctctt cgcactcatg gagaagctga atcattttca gcagcagatg      1020
     aagtgggcta gtcatccggc agtatttttg gagatgtttg ttgtgcaggc ttgccaaatg      1080
     ccgagtcggg aaccggagaa agccgggctt cctgaagagg ttcgtcagca aatcagtacc      1140
     cttgaacata aactcgcaga tttagaacgg cgtttgcaac aggcgccttc gcaggcacct      1200
     gcaggccggc ctgatcagcc agcaagccct tcgcagccgc aggcgcctgt cagaaaacag      1260
     cctcaagcgg catcgaccgg tgccagccgg gcgaatatgc agcgtgtaaa gggtgtgctg      1320
     aatgaagcga cgaaggcaca tctcaaagca attcaccaga aatgggctca gatacaggat      1380
     acggtgaagc agcagaatgt ggctgcatca gcctggctga atgactgtaa gccagtcgtg      1440
     gcatcttcag gtcactacgt ccttgccttt cgaaacgaga tgcatcgcgg catggtggac      1500
     gataaattca gagatctgat cgaaggcgtt gtttcgcagg tgatggatac gcagctcgtt      1560
     atgtataccc tccttgaaca ggactgggaa gaagtgaagg cggcgtttgt caaagaacaa      1620
     aagaagaagc aggccagtca gcccgctgac ggaaatcagg aatcagaaga tgtgcctcag      1680
     gatggcgaca gtgaagcagc cggtcaagca gtggaagatg aacccgaaga agatcagggt      1740
     gaagcggttg ttgatgaagc aatcaaaatg ttcggatccg acctcgtgcg gattgaagaa      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page