(data stored in ACNUC7421 zone)

EMBL: CP001791.PE222

CP001791.PE222       Location/Qualifiers
FT   CDS_pept        243091..243483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97774"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97774.1"
FT                   /translation="MGSGMSLHCRVCGYHRMVMSGIGMSHYSFENCLESCVPAVRKKIR
FT                   KIVKHKVHDYTFEFRCYSCQSCGEIMDKPYLYIQYDDDQTYETRFRCTKCRSRRLLPIE
FT                   EEVLSALPCPSCKEITLTEVGMMLWD"
     atgggaagcg gaatgtcttt acattgtagg gtgtgcgggt accatcgcat ggtcatgtca        60
     gggattggca tgagtcacta ctcatttgag aactgtcttg aaagctgtgt gccggcagtc       120
     aggaagaaga tcaggaagat tgtgaagcac aaggtgcatg actacacctt tgaattccgc       180
     tgttatagtt gtcagagctg cggcgagatc atggataagc cctatctgta cattcaatat       240
     gacgacgatc aaacgtatga gaccaggttt cgctgtacga aatgcagaag caggcgtctt       300
     ttaccgattg aagaagaggt gttatcagcg ctcccttgtc cgagctgtaa agaaataaca       360
     ctaactgaag tcggtatgat gctttgggat tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page