(data stored in ACNUC7421 zone)

EMBL: CP001791.PE227

CP001791.PE227       Location/Qualifiers
FT   CDS_pept        245526..246134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_1413 general secretion pathway
FT                   protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97779"
FT                   /db_xref="GOA:D6XW06"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97779.1"
FT                   /translation="MMGLSRNDQRGLTLIELLAVIVIVGILAAIAVPAVNNVIENSRKD
FT                   AHLATAEAIYEASRLAVIDRQINAGDTDTTAYVFYTGTSSKLNEFLGGGENGIRRVNLV
FT                   EDGYLDSHPINPHTREPYQYTVLLRAGNQSYIQLTYGDGNTEKVFRLPEPSSALDVFIH
FT                   VPSETVRYRTATFRHHRAVSIDKLRREGRDNVKSGSEMR"
     atgatgggtt tgagccggaa tgaccaacga ggattgaccc tcattgaact gttggcggtc        60
     attgtgatag tggggatttt ggcggcgatt gcggtgccgg cggtgaacaa cgtaattgag       120
     aacagtcgaa aagatgctca cttggcaact gcagaggcga tttatgaggc ttctagactt       180
     gctgtaattg accggcaaat aaacgcaggt gacacagata ctacagctta tgttttttac       240
     acgggtactt catcgaaact taatgagttc ttgggaggcg gagagaatgg aatccggaga       300
     gtgaaccttg ttgaagacgg gtatctcgac agtcatccaa tcaatccgca tacgagagag       360
     ccatatcagt atacggtttt actgcgtgcg gggaatcagt catacatcca gttgacatac       420
     ggtgacggaa atacagaaaa agtgttccga cttccggaac caagtagtgc tctggatgta       480
     tttattcatg ttccgtctga aacggtccga tacagaacgg caacttttcg gcaccaccgg       540
     gctgtctcga tcgacaagtt gagaagagaa ggtcgtgata acgttaagtc gggctcagag       600
     atgcgttaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page