(data stored in ACNUC7421 zone)

EMBL: CP001791.PE23

CP001791.PE23        Location/Qualifiers
FT   CDS_pept        33801..34103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dal:Dalk_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97575"
FT                   /db_xref="GOA:D6XV17"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV17"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADH97575.1"
FT                   /translation="MGNMMKQMQKMQKDMAKAQEQLKDETVEATAGGGMVKVIASGEKR
FT                   ILDIQINEEAVDPDDVEMLEDLVLAATNEALNKVDEVVNEKMGKFTKGMNIPGMM"
     atgggaaata tgatgaagca aatgcagaag atgcaaaagg atatggcgaa agctcaggaa        60
     cagctgaagg atgaaacagt agaagctact gcaggcggtg gcatggtcaa ggtcattgcg       120
     agcggggaaa agcgaattct cgatatccag attaatgaag aagctgtcga tccggatgat       180
     gttgaaatgc ttgaagatct tgttcttgca gcgaccaacg aagcgttgaa caaagttgat       240
     gaagtggtaa atgagaaaat gggtaaattc acaaaaggca tgaacatccc cggcatgatg       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page