(data stored in ACNUC7421 zone)

EMBL: CP001791.PE232

CP001791.PE232       Location/Qualifiers
FT   CDS_pept        250961..251809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0240"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease components-like protein"
FT                   /note="KEGG: pfl:PFL_6025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97784"
FT                   /db_xref="GOA:D6XW11"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW11"
FT                   /inference="protein motif:COG:COG1132"
FT                   /protein_id="ADH97784.1"
FT                   /translation="MSETNESLFRPYMKRLAGTYTLSFGESVLELMYPFAIGLAINGLL
FT                   DGQGVVSLVPLIAIWLSQTVFSAVYEMTSARVVARMYRELADQLIIKPEGTKQDDSQVT
FT                   ARVEMVNEVSESFTDVVPGLINGVVGIVVSAVMLFVYDLYAGLVALGLIGINALIQWRF
FT                   GIRAMDLSEKINTRREGQVNIIKARKPASVRKHFKSLTKLNVRFSDTEAGTWAVADVVS
FT                   LGALAAILMIIAGTGAFDAGTIFAMVTYLMTLTDSLEEGPILIEEGAHFLDVSSRLNEK
FT                   V"
     atgagcgaaa ccaatgaatc cttattccgc ccttacatga aacgcctggc cggcacatat        60
     accctctcat tcggtgaatc ggtcctagaa ctgatgtatc cgttcgccat cggcctggcc       120
     atcaacgggc tgttggacgg gcagggtgtc gtgagtctcg ttcccctgat tgccatttgg       180
     ctctcccaga cggtgttcag tgccgtgtat gaaatgacgt cggcacgggt cgtggcccgg       240
     atgtatcggg agctcgcaga tcaactgatc ataaagccgg agggaacgaa gcaggatgac       300
     agccaggtga cagcccgggt agagatggtg aacgaagtga gtgagtcgtt caccgatgtg       360
     gtgcccgggc tcatcaacgg tgttgtcggc atcgtcgtct cggcagtgat gctgtttgtg       420
     tatgatctgt acgcaggcct ggttgcttta ggtctgatcg gaatcaatgc gctgattcag       480
     tggcggttcg gcatccgggc gatggacctc agtgagaaaa tcaatacaag aagagaaggc       540
     caggtcaata tcatcaaggc gagaaagccg gcgagtgtga ggaaacactt caaatccctg       600
     acgaaactca atgtgcggtt cagtgatacg gaagccggca catgggccgt ggcagacgtg       660
     gtctctctcg gggcgctcgc agcgatcctg atgatcatcg ccggcaccgg cgcgtttgat       720
     gcgggcacga tttttgcgat ggtgacgtat ttgatgacgt tgacggattc ccttgaagaa       780
     ggaccgatct taatcgaaga aggggcgcat tttctcgatg tgtcgtcacg gttgaatgag       840
     aaagtgtga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page