(data stored in ACNUC7421 zone)

EMBL: CP001791.PE234

CP001791.PE234       Location/Qualifiers
FT   CDS_pept        252699..253574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97786"
FT                   /db_xref="GOA:D6XWE4"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97786.1"
FT                   /translation="MHLENERLKIEVQPPGTFYSGARFDWTGLISQVTLDGTVQYCVPE
FT                   RLEEGEGTGGHGFCNEFGLDQPVGYEETAPGQRFPKIGTGLLKKEADTAYDIFHPYEVV
FT                   PASMKVIKEDDAVIFEVSQESPGGYAYHLTKTVRLEGTRLIQAYTLLNTGQKPLQTNEY
FT                   SHNFIGMNDTLYNGSYELTIPGLESLDVVVGELSQQGETVTWPVTPTDDVYAGLTLGTG
FT                   VRDRTYHWDLYHRGLKAGVRDLSPFTPSKMALWGRAHVACPEVFIDLRIEPGERASWER
FT                   VYEFYREEAE"
     atgcacttgg agaatgaacg attaaagata gaggtgcagc caccgggtac cttttacagc        60
     ggagcccgct ttgactggac cggcctgatc agtcaggtga ccctggacgg gactgttcag       120
     tactgcgtac cggaacgatt ggaagaaggc gaaggaaccg gtggacacgg tttctgtaat       180
     gaattcggac tcgatcagcc ggtgggctat gaagaaaccg caccggggca acggtttccg       240
     aagatcggca cgggtctgtt gaaaaaagaa gcggatacgg cctatgatat cttccatccg       300
     tatgaggtgg tgcctgcgtc gatgaaggtg attaaagaag acgatgcggt tatctttgaa       360
     gtgagtcagg agagccccgg tggctatgcc tatcacctga cgaaaacggt gcggcttgaa       420
     gggacccgtc tcattcaggc ctatacgctt cttaataccg ggcaaaaacc gctccaaacc       480
     aatgaatatt cccataactt tatcgggatg aacgatacgc tttataacgg cagctatgaa       540
     ttgaccattc cggggcttga gtccctcgac gtagttgttg gcgaactctc gcagcaaggt       600
     gagacggtca cctggcccgt cacgccgacg gacgatgtgt atgcagggct caccttgggt       660
     accggcgtca gggatcggac gtaccactgg gatctctatc acaggggact gaaggcaggc       720
     gttcgggacc tctcaccgtt cacaccgtca aagatggcac tctggggccg ggcgcatgtc       780
     gcctgtccgg aagtgtttat cgatctgagg attgaacctg gggagcgtgc gtcctgggag       840
     cgggtgtatg agttttaccg cgaagaggcg gagtaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page