(data stored in ACNUC7421 zone)

EMBL: CP001791.PE235

CP001791.PE235       Location/Qualifiers
FT   CDS_pept        253729..254757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0243"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   scl:sce1111 lipoprotein releasing system transmembrane
FT                   protein LolC"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97787"
FT                   /db_xref="GOA:D6XWE5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH97787.1"
FT                   /translation="MGLAFKEIKRSKMKFTILGSIIFLISFLTFIISGLANGLAYDNVS
FT                   LIKDLPDGTYYMTEEADGNAAMSEIGEDLEASVLADHDGAFTMATQNGALRDEDDVRHN
FT                   VVFASSSDEERFGALEEGDVLLDESMKEDVQAGDSLTVDQLDLTLTVAGFLDETKYNHA
FT                   AVAWVKRADYETITRSEAMQFLLIPGDDAPTISGLDRFTADEFLNAIPSYSAEQLSLTM
FT                   IVWFLVAISGLLFAIFFYMMNVQKIGLYGILKAIGVKTSTLFGMMWLQMLIITLLSLTA
FT                   AALLSQLFQFAVEGLPFLLAVDQILELSVIFLVIGFLGATASGIQIRYIQPLQAIQQGE
FT                   MA"
     atgggtttgg cattcaagga aatcaagcgg agtaaaatga aattcacgat tctcgggtcg        60
     atcatctttc tgatcagttt tttgacgttt atcatctccg ggctcgcaaa cgggctcgcg       120
     tacgacaacg tctcactgat caaggatctg ccggacggga cgtactatat gaccgaggag       180
     gcggacggga acgcggcgat gtcggaaatc ggcgaggacc tcgaggcgtc ggtcctcgct       240
     gatcatgacg gggcatttac gatggcgacg cagaacgggg cacttcggga tgaggatgac       300
     gtgcggcata atgtggtctt tgcgagttcg tcggatgagg agcggttcgg ggcattggaa       360
     gaaggcgacg tgcttctcga tgaatcgatg aaggaagacg tgcaggccgg ggacagcctg       420
     acggtcgatc agctcgatct gacgctcaca gtggccggat ttctcgatga gacgaagtat       480
     aatcacgcag ctgtggcgtg ggtgaagcgg gcggactacg agacgatcac gcggtcagag       540
     gcgatgcagt tcctcttgat tcccggggac gatgcgccaa cgatcagcgg tctcgatcgg       600
     ttcacggcag atgagtttct gaatgcgatt ccgagctaca gtgccgaaca gctgtcattg       660
     acgatgatcg tctggtttct cgttgccatc agcggtctgt tgtttgcgat tttcttctat       720
     atgatgaacg tgcagaagat cggtctgtac gggatcttaa aggcaattgg cgtgaagacg       780
     tcgacactct ttggcatgat gtggcttcag atgctgatca tcacactgct ttcgcttact       840
     gcggctgcgt tactcagcca gctgtttcag tttgccgtgg aggggcttcc gtttctgtta       900
     gcggtggatc agatccttga actgtcggtg atctttcttg tcatcggttt tctcggggca       960
     acagcatcag gcatacagat caggtacatt caaccgcttc aggcgattca acaaggagag      1020
     atggcataa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page