(data stored in ACNUC7421 zone)

EMBL: CP001791.PE236

CP001791.PE236       Location/Qualifiers
FT   CDS_pept        254757..255428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0244"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: prw:PsycPRwf_0086 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97788"
FT                   /db_xref="GOA:D6XWE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97788.1"
FT                   /translation="MAMFTMEGITKEIQNGEVQESLLKGVSLTLKEGEVTALTGASGSG
FT                   KSTLLTIAAGLQPASEGTIHFNGERVSTMSQEELRALRASSFGFVFQSAHLVPFLNVAD
FT                   QLALMLKVSGTKMKRIERDDRVEELLKAVGMTHRKKAYPASLSGGEKQRVAIARAVIHQ
FT                   PKVLFADEPTASLDSVKSNEVMTLIRNLTKDGQITTLMVTHDQEMLSYADRIVTMKDGI
FT                   I"
     atggctatgt ttacgatgga aggcatcaca aaagagattc agaacggcga ggtgcaggag        60
     tcgttgttaa aaggtgtttc attgacactc aaagaggggg aggtgacggc cctcaccggt       120
     gcgtccggct ccggaaagag cacgcttctg acgattgcgg ccgggcttca gccggcttca       180
     gaaggaacga tccacttcaa cggtgagcgg gtctcaacga tgagtcagga agagctccgc       240
     gcactgaggg cctcatcttt cggcttcgtc tttcaatcgg cgcatctggt gccgtttctg       300
     aacgtggcag atcagcttgc gctcatgctg aaggtgtcag gtacgaagat gaagcggatt       360
     gagcgggacg accgggtgga ggagctgctt aaggccgttg gcatgacgca ccggaaaaag       420
     gcctatccgg cgtcactttc cggcggggag aagcagcggg tcgccattgc ccgggcagtc       480
     attcaccagc cgaaagtgct cttcgccgat gaaccgacgg cgagtcttga ttcggtgaaa       540
     tcaaatgagg tcatgacgct gatccgaaat ctgacgaaag acgggcagat tacgacgttg       600
     atggtgactc acgatcagga aatgctgtcg tatgcagacc ggatcgtgac gatgaaagac       660
     ggcataatat aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page