(data stored in ACNUC7421 zone)

EMBL: CP001791.PE237

CP001791.PE237       Location/Qualifiers
FT   CDS_pept        255585..257015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0245"
FT                   /product="sodium/glutamate symporter"
FT                   /note="PFAM: sodium/glutamate symporter; KEGG:
FT                   dal:Dalk_2099 sodium/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97789"
FT                   /db_xref="GOA:D6XWE7"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE7"
FT                   /inference="protein motif:PFAM:PF03616"
FT                   /protein_id="ADH97789.1"
FT                   /translation="MELDVVSGVMRAIFFTFILISVFLLIGAYLRAKVKIIQNLFLPAS
FT                   VVGGLLGLILGPIVLRDYAVLPIPDDWLMIASLLPGLLIVPVVASVPLGLKMKQTKSSE
FT                   EGGSGSNGSRAIVIMFLILGIIAYAQTFYSLSVASVFKNVFSMEGIYPTFGTELSAGFT
FT                   GGHGTAGVIGSLLQSMDQPYWNTAQGVTTTVATVGIISGILIGILFINIAVRKGFTTFV
FT                   QSGSDMQGGIRTGLNADEASQESAGHETTNSSSIDSMGFHLALILMVSGLAFGIRYVFD
FT                   VNNVLILNMIPEWAYAILLMYGVWGIMIKMKLDWIVDVKTKTKIASTFTEYAVVAAIIS
FT                   LPIQAVFALILPLSIILIGGLAITVLLAYFLSKRYFKEYWFEKSMAILGTNTGVFLTGL
FT                   LLLKMVDPDLKSPVLRDYSISYSLNSLIGFVLFPLAFGFLIAYGYTSAILLYGSLGMLF
FT                   VIGLIIVGKKDKQEVQSI"
     atggaattgg atgtggtttc aggggttatg cgggcaatct ttttcacgtt catcttaatc        60
     agcgtatttt tgcttatcgg ggcctatttg cgggcgaagg tgaaaatcat tcagaatctg       120
     tttttgcctg cttcggttgt tgggggactg ctggggctga tcttaggtcc gattgtattg       180
     cgggattacg ctgtgcttcc gattccggac gactggctga tgattgcctc attattaccg       240
     gggctattga ttgtcccggt tgtggcttca gtacccttag ggctaaagat gaaacagact       300
     aagagttctg aagaaggcgg aagtggttca aatggttcga gagcgatcgt aatcatgttt       360
     ttgatccttg gtattattgc gtatgcgcag acgttttaca gtttatcagt agcgagtgtg       420
     tttaagaatg tcttttcaat ggaaggcatt tatcccactt tcggaacgga attatctgct       480
     gggtttaccg gaggtcatgg gacggccggt gttattggca gtctgcttca gtccatggat       540
     cagccttact ggaatacagc ccagggtgtg acgactacag ttgcaacagt cggaattatc       600
     agtggtattc tgattggtat tttgtttatt aatatagccg tgcgaaaagg gtttacgacg       660
     tttgttcaat caggcagcga tatgcaaggc gggattcgca caggtttaaa tgcggatgaa       720
     gcatcccagg aaagtgccgg tcatgaaaca accaactcct cttcgatcga ttcgatgggc       780
     tttcacttgg cattaatcct catggtcagc ggtcttgcat ttggaatccg ctatgttttt       840
     gatgtgaaca atgtgttgat tttgaatatg attcctgagt gggcgtatgc gattcttttg       900
     atgtacgggg tatggggaat catgatcaaa atgaagttgg actggattgt cgatgtcaag       960
     acaaagacga agattgcgtc gacatttacc gaatatgcag tggtcgcagc gattatcagt      1020
     ttgccgattc aagcggtctt tgctttgatt cttccgcttt cgattatatt gattggcggg      1080
     ttggcgatta cggtgcttct cgcgtatttt ctttcgaaac gttacttcaa agaatactgg      1140
     tttgagaaga gcatggctat tctcgggacg aatacgggtg tgtttctcac tggcctgctc      1200
     ttactgaaga tggtggatcc ggatttgaag tccccggtgc tgcgtgacta ttcgatctct      1260
     tactcgttga acagtctgat cgggtttgta ctgtttccat tggctttcgg atttcttatt      1320
     gcatacggct acaccagtgc aattctcctg tacggctcat tggggatgtt gtttgttatt      1380
     ggattgatta tcgttggaaa aaaagataaa caggaggtac agagcatatg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page