(data stored in ACNUC7421 zone)

EMBL: CP001791.PE244

CP001791.PE244       Location/Qualifiers
FT   CDS_pept        262518..263651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0252"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: vha:VIBHAR_01199
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97796"
FT                   /db_xref="GOA:D6XWF4"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF4"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADH97796.1"
FT                   /translation="MGSITHTIRKARPLSVAVVLILTVSFIGSMLFVHHNHVLYDRTIA
FT                   EVTDVRLVDESETVDQYGNEDRLFDQELDAVIRNGEHEGSVVRLTNQYAESGASDYRFG
FT                   AGDELFVNLDAEHEDGLSGSVTNVKRDQELMLAAWLFLFSLLVVGRRQGLFSVISLGVN
FT                   AALLVVFLQLSIAYAQFSFVAMASVLAIGFTVISLLFVNGFHPKTYAAIIATLLATLSA
FT                   MLITFLTIWLTSGSGLHYESMAFVTRAPQAVFLAGIIIGSLGAVMDVAITVTSSMFAIY
FT                   EKNPAIGRKALIASGLEIGKDIMGTMTNILLFVYVSGSIPVLILYFSNEALLGYTLSVN
FT                   LSLELTRALAGGIGIVLTIPIGLFVTARFVDRKRWRA"
     ttgggatcca ttacacatac aatcagaaaa gcgaggcctt tatccgttgc ggttgtgctg        60
     atcctgacgg tttctttcat cggttcgatg ctgtttgttc atcataatca cgttctctat       120
     gatcggacga ttgccgaagt gacggatgtg aggcttgtgg acgagtcgga gaccgtcgat       180
     cagtacggaa atgaagaccg gctcttcgat caggagcttg acgccgtgat caggaacggg       240
     gaacatgagg gctcggttgt ccgcttaacc aatcagtatg cggaatcagg cgcttcggat       300
     taccggtttg gcgcggggga tgaactgttt gtgaatcttg atgcagagca tgaggacggc       360
     ctgagcggtt cggtgaccaa tgtgaaacgg gaccaggagt taatgcttgc agcgtggctg       420
     tttctgttca gtctccttgt tgttggacga aggcaggggc ttttttccgt catcagcctc       480
     ggggtgaacg ccgccttgct cgtcgtgttc ctgcagctgt cgattgcgta tgcgcagttc       540
     agcttcgtgg cgatggcgag tgtactggcc atcggattta cggtgatttc cctgttgttt       600
     gtcaacggct ttcatccgaa gacatatgcg gccatcattg cgaccctcct ggccacgctc       660
     tcggcgatgc tgatcacgtt tttgacgata tggctgacgt cagggtcggg gcttcattat       720
     gagtcgatgg cgtttgtgac gagggcgccg caggccgtgt ttcttgcagg gatcattatc       780
     ggatcgctcg gggcggtgat ggatgtggcg attacggtga cgtcatcgat gtttgcgatt       840
     tatgagaaga acccggcgat cgggcggaaa gccctcatcg cttccgggct tgagatcggc       900
     aaggatatca tggggacaat gacgaatatc ctcctgtttg tctatgtgag cggatcgatt       960
     ccggtgctca ttttgtactt cagtaatgaa gccctcttag gttacacgct gtcggtgaat      1020
     ctctcccttg aactgacaag ggcgcttgcc ggcgggatcg gcattgtcct gaccattccc      1080
     atcgggctgt tcgtcacggc ccggttcgtt gacaggaaga ggtggcgcgc atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page