(data stored in ACNUC7421 zone)

EMBL: CP001791.PE248

CP001791.PE248       Location/Qualifiers
FT   CDS_pept        complement(269555..270514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0256"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   vap:Vapar_6338 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97800"
FT                   /db_xref="GOA:D6XWF8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH97800.1"
FT                   /translation="MKRFVKWTLIALPIVLIAIAGIIIGGSYLEHQNAIEEDMAYYPAP
FT                   GERIDIHGDGHAMHVHGEGKGGATVVFLAGFGTPSPFYDFQAIRRALPDGYRTVVVERF
FT                   GYGWSDVTDYDRDIGTVTDETRAALKEAGEEGPFILAGHSMAGIEALHYAQAYPEEVTA
FT                   IIGLDPLVPAYYDEHGEEPEVSGVVTFLARSGLMRQQPDVFNENFHAMAKGLLDDDDAE
FT                   AARSVFNRRVQTANMADEAEKLTANVRTVQDAGTPDAPFFAAISSENHDGQPFIEALAA
FT                   DTGGKSRIFDGGHYIHLDQPEAIAKQIVDWMQAEAGSD"
     atgaaacgat tcgtgaaatg gacgctcatc gccctgccga tcgtgctcat cgccattgca        60
     ggcatcatca ttggaggcag ctatctcgaa catcaaaacg ccatcgagga agacatggct       120
     tactacccgg caccaggaga acggatcgac atccacgggg acggccacgc catgcatgtc       180
     cacggcgaag gtaaaggcgg ggcaaccgtc gtttttctcg ccggtttcgg gacaccgtcg       240
     cccttctatg acttccaggc aatccgccgt gccctcccgg atggctaccg gaccgtggtt       300
     gtcgagcgct tcggctatgg ctggagtgac gtgacggact atgaccggga catcggcacc       360
     gtgacggacg agacgagagc cgcccttaaa gaggcgggtg aagaaggacc gtttatcctt       420
     gccgggcact ccatggcagg catcgaagcc cttcactatg cacaggcata tccggaagag       480
     gtcacggcga taatcggcct tgaccccctc gttcccgctt attacgacga acacggagaa       540
     gaacctgagg tgtccggcgt ggtaaccttt cttgcccgtt caggcctgat gcgccaacag       600
     cctgacgtct ttaatgaaaa cttccacgcc atggccaaag gccttctcga tgatgacgac       660
     gcagaagctg cgagaagcgt gttcaaccgg agggtgcaga cggcaaacat ggcggatgaa       720
     gcagaaaaac tgacggccaa tgtccggacg gttcaggacg ccgggacgcc ggatgccccg       780
     ttttttgccg ccatctcaag tgaaaatcac gacggacagc cgtttattga ggcgctcgca       840
     gcggataccg gtggcaagag ccggatcttt gatggcgggc attatattca ccttgatcag       900
     cctgaagcca ttgcaaaaca gatcgttgac tggatgcagg ctgaggcagg ttcagactag       960
//

If you have problems or comments...

PBIL Back to PBIL home page