(data stored in ACNUC7421 zone)

EMBL: CP001791.PE249

CP001791.PE249       Location/Qualifiers
FT   CDS_pept        270686..271606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0257"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: dvl:Dvul_0508
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97801"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF9"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADH97801.1"
FT                   /translation="MNKVDVIILSGFLGAGKTTLLTRLLQADQKHGRKAAVVMNEVGSV
FT                   SVDSDAVGDGTPLKELLGGCVCCSLSDKLEIQLHGLVRDHTLDVIYIETTGVAHPVDVL
FT                   EACMTPLLVDDLRIRSVVTLLDLVAWGERRSLSAAVQQLMREQVRNADLVVMNKADRLS
FT                   EEERSSVEKEIRGINSEGTLLFASFAYVDVRSVMFQESQYSKGRTHAPLHVREDLHIKT
FT                   FTHVFTEPVSQEAFETFVKEMPDSVYRIKGYIRFTGDERTMLLQYSYGMVTYEESDLNR
FT                   TNTLVFIGDGLDHDALRDKLTAIGK"
     atgaacaagg tggatgtcat catcctgtcc gggtttctcg gggcaggcaa aacaacgctg        60
     cttacgaggt tgttgcaggc ggaccaaaag cacggacgca aggcggcagt cgtcatgaat       120
     gaggtgggga gcgtatcggt cgactctgac gcagtgggag acgggacacc gttaaaagag       180
     ctcctcggcg gctgtgtctg ttgctcgttg tccgataaac tcgagattca gctgcacggt       240
     cttgtccgtg atcatacgct tgacgtgatc tatatcgaaa cgacgggtgt tgcccacccc       300
     gtggatgtcc tcgaggcgtg catgaccccg ctgcttgtgg atgatctgcg gatccgttcg       360
     gtcgtaaccc tccttgatct cgttgcctgg ggcgagcgcc ggtccctcag tgccgccgtg       420
     caacagctga tgcgtgaaca ggtcaggaac gcggatcttg tagtgatgaa taaggcggac       480
     cgcctgtccg aggaggaacg gtcgtcggtg gagaaggaga ttcgcgggat caacagcgaa       540
     gggactcttc tgtttgcctc ttttgcctac gtggatgtcc gctctgtcat gtttcaggag       600
     agtcagtaca gtaaagggcg cacccacgct ccgctgcacg tcagagaaga cctccatatc       660
     aagaccttta cacacgtttt cacggaaccc gtgtctcagg aagcgttcga aacatttgtg       720
     aaggagatgc cggacagcgt ctaccggatc aaaggctaca tccgcttcac cggggacgag       780
     cggacgatgc tgcttcagta ttcctatggg atggtgacgt atgaggagtc ggacttgaac       840
     cggacgaaca ccctggtgtt catcggcgac ggccttgatc atgatgcgct cagagacaag       900
     cttacggcga tcgggaagtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page