(data stored in ACNUC7421 zone)

EMBL: CP001791.PE25

CP001791.PE25        Location/Qualifiers
FT   CDS_pept        34833..35045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0026"
FT                   /product="Protein of unknown function DUF2508"
FT                   /note="PFAM: Protein of unknown function DUF2508"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97577"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV19"
FT                   /inference="protein motif:PFAM:PF10704"
FT                   /protein_id="ADH97577.1"
FT                   /translation="MFSRKGKMRREKDAELIALLDRFKRQADEQDARIHQSVNASPEIE
FT                   RQSKLARAKYYFLLREARHRRTRFQ"
     atgttcagcc gaaaagggaa aatgcgacgg gaaaaagatg cggaactcat tgccttattg        60
     gacaggttta agcgccaggc agatgaacag gatgcccgta ttcaccagtc tgttaatgcg       120
     tcaccggaaa ttgaaagaca gtcgaagctt gcccgggcca agtattattt tttgttgagg       180
     gaagcccgtc acagaagaac ccgatttcaa taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page