(data stored in ACNUC7421 zone)

EMBL: CP001791.PE252

CP001791.PE252       Location/Qualifiers
FT   CDS_pept        273219..274169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97804"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97804.1"
FT                   /translation="MTGKRIHLDQAKRWLVRNGRPLEVMRFRYWFEEGSTEDVMDVLTG
FT                   YQNEDGGFGHGIEPDFTCPMSSAIGSWTAARMLFELKTPAAHPVIRKLMDYLIATQNRA
FT                   TGMWQTTFPEISHFPHAPWWSWHEQAQEEWQFNPGVELAAYCLYYGGGDEAATEAGLLT
FT                   MRKALKRLMTVNDMDHHELSNFQYALHILQDQFDAVEADTGFSLRRCEDQLHSLLYQAV
FT                   ETDPLKWGRGYQALPLDVVHSWKDVRNIGFEDGLVEKQIQYWKTTRERDGAWPISWEWG
FT                   QYPEAFAIAKRQWQGILIVERFKKLKQLGMIQEET"
     atgacaggaa agagaattca tctcgatcag gcgaaacgct ggctcgtaag gaacggacgc        60
     cctcttgagg taatgcggtt tcggtattgg tttgaggaag ggtccactga ggatgtgatg       120
     gatgtgctca cgggctatca gaacgaagac ggcggcttcg gccacggcat tgagccggac       180
     ttcacgtgtc cgatgtcgtc ggcgatcggg agctggacgg cagcgaggat gctctttgaa       240
     ctgaagacgc ctgccgctca ccctgtcatc aggaagctca tggattatct cattgccacc       300
     cagaacaggg cgacggggat gtggcagacg acgttcccgg agatcagtca ctttccccac       360
     gccccctggt ggagctggca cgaacaggcg caggaagagt ggcagttcaa tcccggcgtg       420
     gagctcgcgg cttactgcct ctactacggg ggcggagacg aagcggcaac ggaggccggg       480
     cttctcacga tgcgaaaggc tctgaagcgg cttatgaccg tgaatgacat ggatcatcac       540
     gagctcagta attttcagta tgcgctccat attcttcagg atcagtttga cgcggttgag       600
     gcggatacgg gcttctccct caggcggtgt gaagatcagc tgcacagtct gttgtatcag       660
     gctgtggaga cggatcccct caaatggggc aggggttatc aggcgcttcc ccttgatgtg       720
     gtgcattcgt ggaaagatgt ccgtaacatc ggctttgagg atggtcttgt ggagaaacag       780
     atccagtatt ggaagacgac ccgggagcgg gacggtgcct ggccgatcag ctgggagtgg       840
     gggcagtatc cggaagcttt tgcgattgcg aaacggcagt ggcagggaat ccttatcgtg       900
     gagcggttca agaagctgaa acagcttggg atgattcaag aagagacata a                951
//

If you have problems or comments...

PBIL Back to PBIL home page