(data stored in ACNUC7421 zone)

EMBL: CP001791.PE254

CP001791.PE254       Location/Qualifiers
FT   CDS_pept        275883..276236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97806"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97806.1"
FT                   /translation="MSSMNKVIAGDYEGWSVRSHAGSIHLVYKRDDRELTPETVAEWRE
FT                   LEPVTWNEQNMFSSKSLLGSLFLGPLDFLFGISSKTVKLYQLAFKCDDGMKGIMTVDID
FT                   VYHTFLKRFQNEG"
     atgagctcga tgaacaaggt gattgccggt gactatgagg ggtggtccgt cagaagtcac        60
     gccggttcga tccatctggt ttataaacgg gatgaccggg agctgacgcc agaaaccgtt       120
     gctgaatggc gggagcttga gcctgtcacc tggaatgaac agaacatgtt cagctccaaa       180
     agtcttctcg gcagcctgtt tctcggtccg ctcgattttc tgtttgggat atcttccaaa       240
     acggtcaagc tctatcagct ggcttttaaa tgtgatgacg gtatgaaagg cattatgacg       300
     gtcgatatcg acgtctatca cacgtttctg aagaggtttc aaaacgaggg ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page