(data stored in ACNUC7421 zone)

EMBL: CP001791.PE255

CP001791.PE255       Location/Qualifiers
FT   CDS_pept        276297..276626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97807"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97807.1"
FT                   /translation="MSRVYKTSRARAGILSWTKLFHPDEVRLDERSVKVEKKNMMGLKG
FT                   SSDEVTYDRIASVRLSQGLVSGDIVIETSGGSEADLEIRGFRKEVAEKLKDDLSDRLPR
FT                   KGRRK"
     gtgagccgtg tatacaagac aagccgtgcg agggccggga ttctgtcgtg gacgaagctg        60
     tttcatcctg atgaagtgcg gcttgatgaa cggtccgtga aggtggagaa gaaaaacatg       120
     atggggctta aaggttcgag tgacgaggtc acctatgacc ggattgcctc ggtccgtctc       180
     agtcagggac tcgtctcagg tgacatcgtt atcgaaacgt ccggcggttc tgaagcggac       240
     ctcgagattc gcggattccg aaaagaagtg gcagagaagc tgaaggatga tctatcggac       300
     aggctgcccc gtaaaggcag acgcaaataa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page