(data stored in ACNUC7421 zone)

EMBL: CP001791.PE258

CP001791.PE258       Location/Qualifiers
FT   CDS_pept        277951..278571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0268"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: son:SO_1419
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97810"
FT                   /db_xref="GOA:D6XWG8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG8"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ADH97810.1"
FT                   /translation="MKKTWMLSIISATVILGACGNYDSSSEPLPYDNRVDEGESQAADE
FT                   GNENNGNGDEETDFGDLADGVYETTGEGYNDDIVVETTIEGGEIVSVEILSHDETYGIG
FT                   TDATDELPGTIVDANSPDVDGVSGATYSSDGIKEAVRAALEEASGGGSDEDLALTDGVF
FT                   ETSAEGYNDDIVVETTIEGGEIVVSHTMKPTESEPTQQTSCRA"
     gtgaaaaaga catggatgct gtcgataatc agcgccaccg tgattctcgg tgcctgtggc        60
     aattatgatt caagcagcga accgttgccg tatgacaacc gtgtggatga gggtgaaagc       120
     caggcggctg atgaggggaa cgagaacaac ggcaatgggg atgaagagac cgatttcggt       180
     gatttggcag acggtgtgta tgagacaact ggtgagggtt acaatgacga catcgtcgtg       240
     gagacaacga ttgaaggcgg cgaaatcgtg agtgtggaga ttctctcaca cgatgaaacc       300
     tacggaatcg gaaccgatgc aactgatgag ctgccaggca cgatcgtgga tgcgaacagc       360
     ccggacgtcg acggtgtgtc cggtgcgacg tacagttcgg acgggataaa agaagcggtc       420
     cgcgccgctc ttgaagaagc gtcaggcggc ggatctgatg aggatctggc tctgacagac       480
     ggggtctttg aaacgtctgc ggaaggctat aatgacgata tcgtggtcga gacaacgatt       540
     gaaggcggcg aaatcgttgt ctctcacacg atgaaaccga cggaatcgga accgacgcaa       600
     cagacgagct gccgggcatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page