(data stored in ACNUC7421 zone)

EMBL: CP001791.PE26

CP001791.PE26        Location/Qualifiers
FT   CDS_pept        40519..40926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0027"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="KEGG: hha:Hhal_1881 GTP cyclohydrolase I; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97578"
FT                   /db_xref="GOA:D6XV20"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV20"
FT                   /inference="protein motif:TFAM:TIGR03139"
FT                   /protein_id="ADH97578.1"
FT                   /translation="MSENYYLPRSGPMPRPASVEEGRNVLRDEAFPAPDVSVVRFKALE
FT                   FTAVCPKTGQPDFGQVEIEYVPRNKCIESKSLKFYLWSYRDEGAYCESLAAQIADDVMA
FT                   AIEPARVKVMVHQTPRGGIQLETEAERIHEA"
     atgtcagaaa attattattt gccgcgttca ggtccgatgc cgcgtcctgc gagcgtggaa        60
     gaaggaagaa atgtccttcg ggatgaagca ttcccggcac cggacgtttc cgtcgtccgc       120
     tttaaagcac tcgaatttac cgcagtctgt ccaaaaaccg gtcagccgga ctttggtcag       180
     gtggagatcg aatatgtgcc aaggaataag tgcattgaat caaaatcact gaagttctac       240
     ttatggtcgt accgtgatga aggggcctac tgtgagtcac ttgccgctca gattgccgat       300
     gatgtgatgg cagccattga accggcacgg gtgaaagtga tggtccacca gacaccgcga       360
     ggcggcattc agcttgagac ggaggcggag cggatccatg aagcttaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page