(data stored in ACNUC7421 zone)

EMBL: CP001791.PE260

CP001791.PE260       Location/Qualifiers
FT   CDS_pept        complement(279350..280300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0270"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mxa:MXAN_6482
FT                   aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97812"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADH97812.1"
FT                   /translation="MQYRRLGRSGLKISEISLGSWLTYGKSVEDNTAERTIHTAYEAGI
FT                   NSFDSANVYEQGQGERVMAEALKAYPRDSYVISTKAFFPMGEGPNNSGLSRKHITEQLN
FT                   SSLKRMKLDYVDLFYCHRHDPDTPVDETLKAIDDLIRQGKILYAGVSEWSAAQLEEAVS
FT                   IAYRKLLDRIVVNQPQYNMFNRTIEKEIIPVSEKHGIGQVVFSPLAQGVLTGKYKGGQV
FT                   PSDSRAANDDINRFITGMLNEDVMKKVAKLEDVAKELGVSLPELALAWVLRQPNVSSAL
FT                   IGASRPEQVEMNVKASGLVIPDALEETIDTILTEG"
     atgcaataca gacgactagg acgatccgga ctcaaaatca gtgaaatcag cctcggaagc        60
     tggctgacgt acggcaaatc cgtcgaggac aacacggcgg agcgtacgat acataccgct       120
     tacgaagccg ggatcaattc ctttgattca gcgaacgtct atgaacaggg gcagggcgag       180
     cgtgtcatgg cggaagcttt gaaggcctat ccgcgggact catacgtcat ctcgacgaaa       240
     gcctttttcc cgatgggcga aggtccgaac aacagcggtc tgtcgagaaa gcacatcacc       300
     gagcagctca acagcagcct caaacggatg aagctcgact atgtggatct cttctactgc       360
     caccgacacg acccggatac cccggtggat gagacgctga aggccatcga tgacctgatc       420
     cgccagggaa agattctcta cgccggcgtc agtgaatgga gcgcggccca gctcgaggaa       480
     gccgtcagca tcgcctaccg gaagctgttg gaccggattg tcgtcaatca gccgcagtat       540
     aacatgttca accgcacgat cgaaaaagag atcatccctg tcagtgagaa gcacggcatc       600
     ggacaggtcg tcttctcccc gctcgcacag ggcgtattga cagggaaata caaaggcgga       660
     caggtgccga gtgacagccg ggctgccaac gacgacatca accgctttat caccggcatg       720
     ctcaatgagg atgtcatgaa gaaagtcgcc aagcttgaag acgtcgccaa agagctcggc       780
     gtgagtctcc ctgaactcgc cctcgcctgg gtgctccgtc agccgaatgt atcgagtgcc       840
     ctcatcggcg cgagccggcc tgaacaggtg gagatgaacg tgaaggcatc aggacttgtc       900
     attccggatg ccctcgaaga gaccatcgac acgattctca ccgaaggata a                951
//

If you have problems or comments...

PBIL Back to PBIL home page