(data stored in ACNUC7421 zone)

EMBL: CP001791.PE264

CP001791.PE264       Location/Qualifiers
FT   CDS_pept        283096..284982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0274"
FT                   /product="shikimate kinase"
FT                   /note="PFAM: shikimate kinase; KEGG: Os06g0225800;
FT                   hypothetical protein; K00891 shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97816"
FT                   /db_xref="GOA:D6XWH4"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWH4"
FT                   /inference="protein motif:PFAM:PF01202"
FT                   /protein_id="ADH97816.1"
FT                   /translation="MRRDHHEIVITGIACVGKSTVGQLLAERMGHVFYDLDLEIEQAFG
FT                   MPISRIKEQITTEREYRKKTAPVLEKLMQGRDWVIASTPSGLKDHYWKLIEKDPEIVTV
FT                   VLRDRAARIVERLTFYDDDSRLIPSPVTAANRHLYERDIQQDMTYYGTSHRKADVKFQI
FT                   KGRPANQAAEALYEEIMAFTPKDKEKEKVAETLVEYDDREPVVCDVPHPLVQDYDRLLR
FT                   FMMEKDVYVTKKKREISSVFLPELNGLLALKRPASVKGKAQAAYPVIHLFFTLAINSGL
FT                   LAIQEGPRGRMYVKADEERLRAYRQLSDLEIYYLLLETLWTDTDWANVTDRGKTEHVYL
FT                   FQKVLIQIVRHARPGEPFPVRRDWVDRFADYFSWFAFWTEAEDEEYRTFEQQEPGFRNV
FT                   FVLVHVHRDAKERIQTLLFDRNLEQWNLPFRKVTGELNPQPGDAAKEWFGLDEEDEFER
FT                   QLQEAIGIDRRHEAFFEAFVSLHSEEVIERTLPRNVVSFEPGLHMLRITYLSVSREMIV
FT                   SQETTLAELHGMILEAFDLTDDHLYAFFLDGILYSEPAVYAPQADEEHRADEVTIGSLG
FT                   LRKGQSFVYVYNFVHEIILDIDVCFVDDRAEVTDVRSFGDAIGHPPWSDEGV"
     atgaggaggg atcatcatga aatcgtgatc acagggatcg cctgtgtcgg aaagtcaacg        60
     gtggggcagt tgctcgcaga gagaatggga cacgtgtttt acgatctcga tctggaaatt       120
     gaacaggctt tcggcatgcc gatcagccgt atcaaagagc agataacgac cgagcgggag       180
     taccgcaaga agacggcgcc tgttctggag aaactgatgc agggccggga ctgggtcatt       240
     gcttccacac cgagcggact gaaggatcat tattggaagc tgattgagaa ggacccggag       300
     atcgtaacgg ttgtccttcg cgatcgggca gcccgtatcg tggagcgtct gacattttac       360
     gatgacgatt cccgcctcat tccctctccg gttacggcag ccaaccggca tctgtatgag       420
     cgcgacattc agcaggacat gacgtattac ggaacgagcc atcgaaaagc ggatgtgaag       480
     tttcaaataa aaggccgtcc tgccaatcag gcggccgaag cgctctacga ggaaatcatg       540
     gcgttcacac ccaaagacaa ggagaaagag aaagtcgctg aaacattggt tgaatacgat       600
     gacagggagc cggttgtttg cgacgtgccc catccgctcg ttcaggatta tgaccgtctt       660
     cttcgattta tgatggaaaa ggatgtttat gtaacgaaga agaaacgtga aatcagttca       720
     gttttcttgc cggagctgaa tggccttctg gctcttaagc ggcctgcatc cgtcaaggga       780
     aaagcccagg cggcctatcc tgtgattcat ctcttcttca cgctcgccat caacagcggc       840
     cttctcgcta ttcaagaggg accgcggggg cggatgtatg tgaaagctga tgaagaacgg       900
     ttacgggcat accgtcagct gtcggatctg gagatttatt atctgctttt ggagacgctg       960
     tggacggaca cggactgggc gaatgtgacg gatcgcggga aaacggaaca cgtgtatctg      1020
     tttcagaaag tactcatcca gattgtcaga catgcacgac cgggagaacc cttccctgtc      1080
     agaagggact gggtggatcg ttttgccgac tatttctcat ggtttgcgtt ctggacagaa      1140
     gcggaggatg aggagtatcg cacgtttgaa caacaggagc ccgggttccg gaatgtcttt      1200
     gtcttagtcc atgtgcacag ggacgccaag gagcggattc agacacttct gtttgatcgg      1260
     aaccttgaac agtggaatct cccgttccgg aaagtgacag gtgagctgaa tcctcagccg      1320
     ggtgatgccg caaaggaatg gttcggattg gatgaagagg acgaatttga gaggcaattg      1380
     caagaggcga ttggcattga caggcgccat gaagcgtttt ttgaagcgtt tgtttccctc      1440
     cattccgagg aagtgatcga acggaccctg ccaagaaacg tcgtaagctt tgagcccggg      1500
     ctgcatatgc ttcgtatcac gtatctgtct gtatcaagag agatgattgt gtcccaagag      1560
     acgaccttgg ctgaactcca tgggatgatt ttagaggcat ttgatctcac tgatgatcat      1620
     ctgtacgcct tttttctgga tggcatcttg tattcagagc cggcggtgta tgcgcctcag      1680
     gcagatgaag aacaccgtgc ggatgaggtg accatcggtt cactcggcct gcgaaaggga      1740
     cagtcgtttg tgtatgtgta taactttgtg catgaaatca tcctcgatat tgacgtatgc      1800
     tttgttgatg atcgggctga agtgacagac gtccgttcct ttggcgatgc gatcggtcat      1860
     ccgccctggt cggacgaggg tgtgtaa                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page