(data stored in ACNUC7421 zone)

EMBL: CP001791.PE27

CP001791.PE27        Location/Qualifiers
FT   CDS_pept        40916..41563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6876 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: protein of unknown
FT                   function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97579"
FT                   /db_xref="GOA:D6XV21"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV21"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ADH97579.1"
FT                   /translation="MKLNLTRSELLVLLNVIFATSLVIANVLAGKLVAFGEFIVIPAAV
FT                   ITYAFTFLITDVIHEKYGHETAKRTIIFGFIAQIFASTMIVLGGFLPVAPFAAESQAAY
FT                   ETLLGQNYRFAFASMAAYLGSQFFDVYVFKKLKEKTRSEKKWLRNNVSTASSQFVDTTI
FT                   FITIAFAGTVPNLWIMIVSQYAVKLIIALIDTPIFYLLTRRSSEEEESRQAS"
     atgaagctta acctcaccag gagtgaactt cttgttctcc tgaacgtcat tttcgccacg        60
     tcgcttgtga tcgccaatgt gcttgcaggg aagctcgttg cattcggtga gtttattgtg       120
     atccccgccg cggtgatcac ctacgccttt acctttttga ttacggatgt gatccatgaa       180
     aaatacggcc atgaaacggc aaagcgaacg attatatttg gtttcattgc acaaatattt       240
     gcaagtacga tgattgtgct gggcggtttc ctccctgtgg cgccctttgc ggcagagagt       300
     caggccgctt acgagacgct cctcggtcag aactaccgct ttgcctttgc atccatggct       360
     gcatatctcg ggagtcagtt ctttgatgtg tacgtgttta aaaaactgaa ggaaaagacc       420
     cggtctgaga agaagtggct tcgaaacaat gtcagtacgg cctcttcgca gtttgtggat       480
     acgacgattt ttattaccat tgcgtttgcc ggaaccgtgc cgaatctctg gatcatgatt       540
     gtgagccagt atgcggtcaa gctgatcatc gccctgatcg atacgccgat tttctatctc       600
     ttgacgagac gttcgtctga agaggaagaa agccggcagg cgtcataa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page