(data stored in ACNUC7421 zone)

EMBL: CP001791.PE270

CP001791.PE270       Location/Qualifiers
FT   CDS_pept        290291..291298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0280"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: aeh:Mlg_1052 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97822"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97822.1"
FT                   /translation="MNGQSQTEEALHQALDHYYDVYFRRGDIRETLALVDGDSTGAGTG
FT                   AGEMAYTYDDVVRLYKQDLGQAPNEVHFEELSRTVTALNPDSGLTFSLLNLETEIMHQR
FT                   LKFNQLRLTMVWRRDQKDQVFKIVHLHASFPTNEHEADESYPVKELEERNRVLERLVQD
FT                   RTRELELSLEQQRDAASTDRLTGLRNRASLEDLLEMEINRAVQEEAVFAVILMDMDHFK
FT                   RINDTHGHQAGDSCLKELAELLIRQSRPTDIVGRWGGEEFLIICPNTDERGSKDLAESF
FT                   RLAVSAYRFTKTGAQTASFGVAAFMTGDDGETLIGRADRALYRAKGAGRNRVEV"
     atgaacggac agagccagac ggaagaagca ctgcaccagg cgttggatca ttattatgac        60
     gtgtatttcc ggcgtggtga catcagggag acgctggccc ttgtggacgg ggactcgacg       120
     ggggccggca cgggtgcagg ggaaatggca tatacgtatg acgatgtggt gagactctat       180
     aagcaggatc tcggtcaggc accgaatgaa gtccacttcg aggaactcag tcggacggtt       240
     accgccttga atcctgattc gggtctgact ttctcactgc tcaatctgga gacggagatc       300
     atgcatcagc gcctcaaatt caatcagctt cgattgacca tggtgtggcg gcgggatcag       360
     aaggatcagg tgttcaagat cgtgcatctg catgcttcgt ttccaacgaa tgaacacgaa       420
     gccgatgaat cgtacccggt gaaggagctc gaggagcgga accgggtgtt ggagcgcctc       480
     gtgcaagacc ggacccggga gctggaactg tcgctcgagc aacagcgtga tgcagcgtca       540
     acggaccggc tgacaggcct tcggaaccgg gcgagtctcg aggatctcct cgagatggaa       600
     atcaatcgtg ccgtccagga agaagcggtc ttcgcggtga ttttgatgga tatggatcat       660
     tttaagcgga tcaatgatac acatggtcat caggccggag acagctgcct gaaggaactc       720
     gcagaactcc tcatcagaca aagccgccca acggacatcg tcggcagatg gggcggggaa       780
     gaatttctga ttatctgccc gaatacggac gaaagagggt cgaaggatct cgcagagtcg       840
     ttccggttgg ctgtttcggc ataccgattc acaaaaacgg gcgctcagac ggcaagcttc       900
     ggtgtggcgg catttatgac gggcgatgac ggtgaaaccc tcatcggacg ggcggatcgt       960
     gcgttgtacc gggcaaaagg agcggggcgg aaccgggtgg aagtgtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page