(data stored in ACNUC7421 zone)

EMBL: CP001791.PE271

CP001791.PE271       Location/Qualifiers
FT   CDS_pept        complement(291364..292968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0281"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: tcx:Tcr_1143 diguanylate cyclase;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97823"
FT                   /db_xref="GOA:D6XWI1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97823.1"
FT                   /translation="MKQLDTIQANKEGDPIKSPQPFQLNKKRLFLLLALGLLFMSLLGL
FT                   LFNRTYVSTKESYMGAEMDAFESKIYTTLELYENFSDFIFEEHINQDDVLALVEQGVFG
FT                   TEDEQNAARRMLFSELSETYDAVLNYDFRQLHFHTREGDSFLRFHAPELYGDSLMDIRD
FT                   SIRMANTEERFVFGFEEGRIFNGYRFVYPLHRNGRHLGSVEVSISMGSLVQMIGSLYPD
FT                   DVLTFVIREDIVRDTVFESEQTNYSTAPFFPGYALDEGISSQSERCVCDTAFSMNCSVI
FT                   ETIVSDNEELTGEGASFNRLTTQNGQDVLVNFLSVTNLSDQHVAYLIGMHEIEDGSVFG
FT                   HYHLNRDLALLALFFSFYAYSIFMYERKQKQLGILANTDQLTGLFNRHYMMKQLEDNRQ
FT                   KGSGFKQPAILILLDIDRFKRINDEFGHQTGDAVLSETGALLHKLAGSHGTAARWGGEE
FT                   FVLYLPGYAKAEGTAFAEQVRSAIETHAYSKGLSVTASIGVSSTEDPDTPHIDALVQRA
FT                   DHKMYEAKEAGRNLVKA"
     atgaagcagc tcgacaccat tcaggcaaac aaagaaggtg atcctattaa gtctccacaa        60
     ccgtttcagc tcaataaaaa aagactgttt ctgttgctgg cactgggcct gttgttcatg       120
     agcctcctcg gtctcctgtt caaccgcact tatgtctcga caaaagaatc ctatatgggt       180
     gcggagatgg atgcctttga atccaaaatc tacaccacgc tcgaactcta cgagaatttt       240
     tctgacttta tttttgaaga gcacatcaat caggatgatg tccttgccct ggtcgaacag       300
     ggcgtattcg gcacggaaga cgaacagaac gctgcgcggc gaatgctctt cagtgaactc       360
     tctgaaacct atgacgcggt gttgaactat gatttcagac aactccattt tcacaccagg       420
     gagggcgaca gttttcttcg cttccatgcc ccggaacttt atggtgattc actgatggac       480
     atacgtgact ccatcagaat ggccaatacc gaagaacgct tcgtcttcgg cttcgaagag       540
     gggcgtatct ttaacggcta ccggtttgtc tatccccttc accgaaacgg gcggcatctc       600
     ggatctgtgg aagtctcgat ttccatggga agccttgttc agatgatcgg gagtctgtac       660
     cctgatgatg ttttgacctt cgtcatccgt gaagacatcg tcagagatac cgtattcgaa       720
     tccgaacaga cgaactattc aacggccccc ttcttccccg gctatgccct ggatgaaggc       780
     atctcctctc aatctgaacg ttgtgtatgt gacacggcat tcagtatgaa ctgcagtgtc       840
     atcgagacca tcgtctcaga taacgaagag ctgaccggag agggcgcaag ctttaatcgg       900
     ctgacaacgc aaaacggaca ggatgtcctc gtcaatttcc tgtctgttac gaacctctcg       960
     gatcagcacg tcgcctacct gatcggcatg catgaaatcg aggacggcag cgtttttggc      1020
     cactatcacc tgaaccggga ccttgctttg cttgcccttt tcttttcctt ctatgcctat      1080
     tccatcttta tgtatgaacg caaacaaaaa cagctcggga ttctcgcgaa tacggatcaa      1140
     ctcaccggcc tctttaaccg gcactacatg atgaaacagt tggaagacaa ccgccaaaag      1200
     ggatcaggat tcaagcagcc cgcaatactg attctccttg acatcgaccg cttcaaacgg      1260
     atcaatgatg agttcggtca ccagaccggt gatgcggtcc tctctgaaac aggtgccctg      1320
     ttacacaagc ttgccggttc ccatggcaca gctgcccgct ggggcggaga ggagtttgtg      1380
     ctgtaccttc cgggctatgc caaagcggaa ggaaccgcct ttgccgaaca ggtccgctca      1440
     gccatcgaaa cacatgcata cagcaaagga ctgtctgtca cggcgagtat cggtgtctcc      1500
     tccaccgaag acccggatac cccgcatatc gatgccctcg ttcagcgtgc agaccataag      1560
     atgtatgaag cgaaggaagc cgggcgaaat cttgttaaag cctga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page