(data stored in ACNUC7421 zone)

EMBL: CP001791.PE272

CP001791.PE272       Location/Qualifiers
FT   CDS_pept        complement(293243..293812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0282"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: eba:ebA6393 putative glutathione peroxidase
FT                   protein; PFAM: glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97824"
FT                   /db_xref="GOA:D6XWI2"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI2"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADH97824.1"
FT                   /translation="MSVYDFKVKTSSGLNAPLNRYQGKVLLIVNTATKCGFTPQLDDLQ
FT                   KLQDQYGEQGLQILGFPSNQFDNQEPLGDGEITEFCSLNYGVNFPLFKKIDVRGEDAHP
FT                   LYQHLTKAKPFNGFDMDHPTAKLMVSIIESKHPEYMLDDGIKWNFTKFLIDRNGEVTAR
FT                   FEPTVEPFDMKADIEALLQSETALNQ"
     atgagcgtat acgatttcaa agtcaaaaca tccagcgggc tgaatgcccc attgaaccga        60
     tatcagggaa aggtgctcct catcgtcaat acggcgacga aatgcggctt caccccacag       120
     ctcgatgacc ttcagaaatt gcaggatcag tacggtgagc agggtcttca gatcctcggc       180
     ttcccgtcca atcagtttga caaccaggaa ccccttggcg acggtgagat caccgagttc       240
     tgttcgttga actacggcgt gaactttccc ctctttaaga agattgacgt ccgcggagaa       300
     gatgcccatc cgctgtatca gcacctgaca aaagccaagc ctttcaatgg cttcgacatg       360
     gatcatccga cggcgaagct gatggtctcc atcattgaga gcaagcaccc ggagtacatg       420
     ctcgatgacg gcatcaaatg gaacttcaca aagtttctga tcgaccggaa tggtgaagtg       480
     acagcacgat tcgaaccgac tgttgaacca ttcgacatga aggccgatat cgaggcattg       540
     cttcaaagtg aaacagcact aaaccaataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page