(data stored in ACNUC7421 zone)

EMBL: CP001791.PE274

CP001791.PE274       Location/Qualifiers
FT   CDS_pept        297715..299322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0285"
FT                   /product="Putative exporter of polyketide antibiotics-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97826"
FT                   /db_xref="GOA:D6XWI4"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI4"
FT                   /inference="protein motif:COG:COG3559"
FT                   /protein_id="ADH97826.1"
FT                   /translation="MKHTESFAGMRVLLLLALRRDRIKLPVWIASITAFAAWIVHIYGD
FT                   FSPREMTEVTVMASISPGMRVLVAPVTEAGVGELGSFFLLRMSLILALFVALMSVQLVL
FT                   RHTRMNEETGCAELTGSLPVGRYALLGAAMILGAGSNLVLGVALSLSFAVQGLDTFGAW
FT                   LAGMSFAGLGFVMTAVASVAAQLSETQRGASGYATMALAGFAGIASVSNVIGDVHESGF
FT                   GFTSHWLAWLSPIGWLQQVQAFEENRWLPLVLLYGAGLCLMYMATLIAEGRDIGAGVLP
FT                   ARKGPAYGAPRLLSPFGLAWRLQRKTLIAWFLPVAAFAAIFGASSGEYGEIAEGIAAFE
FT                   AVIESEAYFLMSFISIMTAILSIYAMQTIMRMRAEEKSGLVEMLLATAVPRTTWVRSYA
FT                   FLGLAGAFVLILTFTSMLTVSSGAGMDVFSDYLLAGLAQGTALFALSGAVLFFFGWLPR
FT                   FAVTLSWLAVFASILAGPFFGAILELPEWVLNVSPFSHVAIMPEEVSAFSLAMLLVTGL
FT                   ILLILGVTGFQRRSLTLT"
     gtgaagcata cagagtcatt tgccggaatg cgagttctgc ttctccttgc gttgcgtcgg        60
     gaccggatca agctccctgt ctggatcgca agcatcaccg catttgcggc ttggatcgtg       120
     catatttacg gggacttctc cccccgggag atgaccgaag tgacggtcat ggcatccatc       180
     agtccgggga tgcgggtgct cgttgctccg gtgacggaag cgggggttgg tgaactgggt       240
     tctttctttc tgctcagaat gtcactgatt ctcgccctct tcgttgcgct gatgagtgtg       300
     cagcttgtgt tgcgccatac aaggatgaac gaagagaccg gctgtgccga gttgacgggc       360
     tcactgcctg tgggacgcta tgccctcttg ggtgcagcca tgattctcgg tgccggttcg       420
     aaccttgttt tgggggtggc cctgtctctt tcctttgccg ttcaggggct ggacactttt       480
     ggggcatggc ttgccggcat gtcttttgcc ggtctcggtt ttgtcatgac cgcggttgca       540
     tccgtggccg cacagctgtc cgagacgcag cgcggggcat cgggctacgc gacaatggca       600
     ctggccggct ttgcaggcat tgcgtctgtc agtaacgtga tcggtgacgt gcatgagagc       660
     gggttcggat ttacgagcca ttggctggct tggctgtcgc caatcggttg gctgcaacag       720
     gtacaggcct tcgaagagaa tcggtggctg cctctcgtgc tgctgtatgg tgccggattg       780
     tgtctgatgt acatggcaac cctcatcgcg gagggtcggg atatcggggc gggtgtgctg       840
     cctgcgagaa aaggaccggc ttatggtgca cctcgtcttc tcagcccttt tggtctcgcc       900
     tggcgattgc agcgaaagac cctgatcgcc tggtttcttc cggttgcggc ttttgccgcc       960
     atctttggag catcaagcgg ggaatacggt gaaattgctg aggggattgc cgcttttgag      1020
     gcggttattg aatcagaagc ctattttctc atgtcgttta tcagcatcat gactgccatt      1080
     ctgtccatct atgccatgca gacgatcatg cggatgcgcg cagaggagaa aagcggtctt      1140
     gtggaaatgc ttctggctac ggcggttccc cgtacgacat gggtcagaag ctatgcgttt      1200
     ctgggtcttg ccggggcgtt tgtactgatc ctgaccttca catcgatgct taccgtttcc      1260
     tcaggagcgg gcatggacgt cttcagtgat tatctccttg cggggctcgc gcagggtaca      1320
     gcgctttttg ccctgtcagg tgccgtcctg ttcttctttg gctggctgcc ccgctttgcg      1380
     gtgacgctct cctggttggc cgtgtttgct tcgatccttg ccgggccttt tttcggggcg      1440
     attctggaac tgcctgaatg ggtgctgaac gtatccccgt tctcccatgt ggccattatg      1500
     ccggaagagg taagtgcatt ctcccttgcg atgcttctcg tcaccgggct gatcctgttg      1560
     atccttggtg taacggggtt tcaaaggcgc tctctcacat tgacataa                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page