(data stored in ACNUC7421 zone)

EMBL: CP001791.PE275

CP001791.PE275       Location/Qualifiers
FT   CDS_pept        300640..301545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0287"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: dma:DMR_20610 GGDEF domain
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97827"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH97827.1"
FT                   /translation="MEMKPEELDVLISQLTASEHLYGHIRVVDPVHKRVVYQNTGHGLE
FT                   PVSDLRACFELFDKKTACRNCISMRAYHENESFIKVETSPDRVHMVTAIPVEIAGRKVV
FT                   VEFFKDVTNSMIMDDASFNQGVEMKRLLDQANLAAVTDELTRVYNKRYILEKLPADLTL
FT                   ALAEQQPFGLIVADIDHFKSVNDTYGHLAGDQILREFAAVLKDTCLDQADWTARFGGEE
FT                   FVVCLPGKDRDTVLAVAERMRARIEEQVFHYDGQAITLTSSFGVYALAPGDVIDYETLL
FT                   KRADQHLYQSKRTGRNRVTG"
     atggagatga aaccggaaga actggatgtc ctgatcagtc aattgactgc atcagagcac        60
     ctgtatggcc atatccgcgt ggttgatccg gtgcataaac gggtggtcta tcagaacacc       120
     ggacatggac ttgaacctgt gtcggatctg agggcgtgtt tcgagctgtt tgataagaaa       180
     acagcctgtc gaaattgcat ctccatgcgg gcgtaccacg agaatgagtc ttttatcaaa       240
     gtggagacat caccggaccg ggtgcatatg gtgacggcga ttcctgtaga gattgccggc       300
     cggaaagtgg tcgtcgagtt ttttaaagac gtgacaaaca gcatgatcat ggatgatgca       360
     agtttcaatc agggagttga aatgaagagg ctgctcgatc aagccaatct ggctgccgtg       420
     actgatgaac tgacgagggt gtataacaaa cgctatatcc ttgagaaact gcccgcggac       480
     ctgacccttg ctttggcgga gcaacagcca ttcggattga ttgtggcgga tatcgatcat       540
     ttcaaatcag tcaatgatac gtatggacac cttgcaggtg atcagattct gcgtgaattc       600
     gcagctgtgc tgaaagacac gtgcctggat caagcggact ggacagcacg ttttggcgga       660
     gaggaatttg tcgtctgtct gcctggaaaa gaccgggata ccgtgctggc cgttgccgag       720
     cggatgcggg cacgaattga agaacaagtc tttcactatg atggacaggc catcacgctg       780
     acgtcgagtt ttggtgttta tgcattggca ccgggtgacg tgattgatta tgaaaccctt       840
     ttgaagcggg ctgaccaaca tttgtatcaa tcaaaacgga caggacgaaa ccgtgtgact       900
     ggatga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page