(data stored in ACNUC7421 zone)

EMBL: CP001791.PE279

CP001791.PE279       Location/Qualifiers
FT   CDS_pept        complement(305316..305972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0291"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: sdn:Sden_3055 response regulator receiver;
FT                   PFAM: response regulator receiver; regulatory protein LuxR;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97831"
FT                   /db_xref="GOA:D6XWI9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWI9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97831.1"
FT                   /translation="MTTQILLAEDQSLVRQGLKMMIETAPDLRVTAEANNGEEALRLLA
FT                   AKPAITLAILDIRMPVMNGLELAKAIQEHHPHVMTLMLTTFNDDDYAIEALRHGARGYL
FT                   LKDADPDALIRGIRTCLEGGLALEPHVAANVVPLLMNKPETKPEFPALPEDITERETTV
FT                   IACVGRGLSNKEISEELYLSVGTVKNLISVILHKLELRDRTQLAIYAIRSGFTER"
     atgacgacac aaatcctgct cgctgaagac cagagccttg tccgccaggg gctgaagatg        60
     atgatcgaaa ccgcacctga cctccgtgtg acggcagaag cgaataacgg cgaagaagcc       120
     ctgcggcttt tggctgcaaa gcctgccatt accctcgcca tcctcgacat ccggatgcct       180
     gtgatgaacg gtcttgagct tgccaaagcc attcaggagc accatcccca tgtgatgacg       240
     ctcatgctca cgacctttaa tgatgacgat tatgccatcg aagctctccg tcacggagcg       300
     agggggtatc tgctgaaaga cgctgatcca gacgcgctta tccgggggat ccgcacctgt       360
     ctcgaaggcg gtctggcctt ggaaccccac gtcgcggcga acgtggtgcc ccttctgatg       420
     aacaagccgg aaacaaaacc cgagttcccc gctcttccgg aagacatcac agaacgggaa       480
     acaaccgtca tcgcctgtgt cggccgcggt ctcagtaaca aggaaatttc tgaagagctg       540
     tacttaagcg tcggcaccgt gaagaatctg atcagtgtca tcctgcataa actcgaactc       600
     agagaccgca cgcagctcgc catctacgcg atccgcagcg gcttcaccga aagatga          657
//

If you have problems or comments...

PBIL Back to PBIL home page