(data stored in ACNUC7421 zone)

EMBL: CP001791.PE281

CP001791.PE281       Location/Qualifiers
FT   CDS_pept        complement(307197..307823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0293"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: apj:APJL_0059 nitrate/nitrite response
FT                   regulator protein; PFAM: response regulator receiver;
FT                   regulatory protein LuxR; Sigma-70 region 4 type 2; SMART:
FT                   regulatory protein LuxR; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97833"
FT                   /db_xref="GOA:D6XWJ1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH97833.1"
FT                   /translation="MERIKLLIVDDHEMVRTGLRTFLELEDDFEIVAEASDGQEAIDKA
FT                   NETRPDIILMDLLMDGMSGIDATAKLAPEGYKIIVLTSFLDDDMLFPVLDAGAFSYLLK
FT                   TSTAADIADAIRKAFRGEPTFQGKVTTKMYRRFQERPKHDVLTKREREVLALLGEGKSN
FT                   QEIADTLFIAVKTVKTHVSHILAKLDLQDRTQAAIYANKHQLTAN"
     atggagagga ttaaactgtt aattgtcgat gatcatgaga tggtccgcac agggctccgg        60
     acgtttcttg agcttgaaga tgactttgag atcgtcgcag aagcctcaga cggccaggaa       120
     gccattgaca aagccaacga gacccggccg gatattatcc tgatggattt attgatggat       180
     gggatgagcg ggatcgatgc gacggcaaag ctcgctccgg aaggctataa gatcatagtc       240
     ctgacaagct ttcttgacga cgacatgctg tttcccgtcc tcgacgccgg ggcattcagc       300
     tacctgttaa agacgtcgac ggcagctgac attgcagacg cgatccgtaa agccttccgg       360
     ggggaaccga cctttcaggg gaaggtgacg acgaagatgt accggcggtt tcaggagcgt       420
     ccgaagcatg acgtcctgac gaaacgcgag cgggaagtcc ttgcgcttct cggtgaaggg       480
     aagagtaacc aggagattgc cgacacgctc ttcattgccg tcaagaccgt gaagacccac       540
     gtcagccata tcctcgcaaa gctcgacctg caggaccgga cccaggcggc aatctatgcg       600
     aataagcacc agctgacggc caactga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page