(data stored in ACNUC7421 zone)

EMBL: CP001791.PE283

CP001791.PE283       Location/Qualifiers
FT   CDS_pept        complement(308918..309853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0295"
FT                   /product="Cell wall-active antibiotics response protein"
FT                   /note="PFAM: Cell wall-active antibiotics response protein;
FT                   KEGG: xcb:XC_1549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97835"
FT                   /db_xref="GOA:D6XWJ3"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ3"
FT                   /inference="protein motif:PFAM:PF09922"
FT                   /protein_id="ADH97835.1"
FT                   /translation="MKNLTALIIILLGTGFLLSNLGIIEGSFSNLIGTYWPAIVIWFGV
FT                   KWFFQGLAVFYHSLKRDRKNIGQIIWGFYVTVIGGVLLGNNTGYFDYTLSDVWNWTWPL
FT                   LIIYIGFKILFDREGDVVIHLGPDDVEKYSRKSKSPYHDEPEPLDDDAISAKAQKKAEK
FT                   AKRKAQAFADGKTGNYQKKSCGGYTTGAKRSLIGDFKLGNKPWEPDGKDLALGIGDVEI
FT                   DFTRAVLKPGLNEMRVDCWIGDISVLIPSHMPVRVEAEVKLGEVTLFNDSHAGTGRSAA
FT                   YTSPDFDTADEQLVILIQLSIGEIEVMTVD"
     atgaaaaatc tgaccgctct gatcattatc ctgttaggca ccggcttcct gctttcaaac        60
     ctcgggatca tcgaaggatc cttttcaaac ctgatcggca cctactggcc ggccatcgtg       120
     atctggttcg gcgtgaagtg gttcttccag ggactcgccg tgttttacca cagcctgaag       180
     cgcgaccgta aaaatatcgg ccagatcatc tggggctttt atgtcaccgt cattggcggg       240
     gtcctcctcg gcaataacac cggctatttt gactacaccc tctcggatgt gtggaactgg       300
     acctggccgc tgttaatcat ctacattggc tttaaaatcc tcttcgaccg tgaaggggac       360
     gtcgtgattc acctcggacc ggacgatgtg gagaaatact cccgaaaatc aaagagcccg       420
     tatcacgatg aaccagaacc gcttgacgac gatgcgatat ccgcgaaagc ccaaaagaaa       480
     gcggagaagg ccaaacgaaa agcccaggcc ttcgcagacg ggaaaaccgg taattatcag       540
     aagaagtctt gcggcggcta tacaacaggc gcgaaacgtt cgctcatcgg cgatttcaaa       600
     ctcggcaaca agccctggga gccggacggt aaagatctcg ctctcggcat tggtgatgtg       660
     gagatcgact tcacaagagc cgttctgaag cccggcctga atgaaatgcg ggtggactgc       720
     tggatcggtg acatcagcgt tctgatcccg agccacatgc cggtaagagt cgaggcggaa       780
     gtcaagcttg gagaagtgac tctctttaat gattcccacg ccggtacagg ccgttccgct       840
     gcctatacga gcccggattt cgacacggcc gacgaacagc ttgtcatcct gattcagctg       900
     tccatcggcg agatcgaggt gatgaccgtt gactga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page