(data stored in ACNUC7421 zone)

EMBL: CP001791.PE284

CP001791.PE284       Location/Qualifiers
FT   CDS_pept        309971..310117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97836"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97836.1"
FT                   /translation="MDRLTQRGVRTESQRVSDECADLLQAGFHDHHAFLKCFVCDANER
FT                   LIR"
     atggatcggc tgacccaaag aggggtccgt accgaatcgc aacgtgtctc tgatgaatgc        60
     gcggatcttt tgcaggcggg ttttcatgat catcatgcct ttcttaaatg ttttgtatgt       120
     gacgccaacg aacggctgat tagatga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page