(data stored in ACNUC7421 zone)

EMBL: CP001791.PE287

CP001791.PE287       Location/Qualifiers
FT   CDS_pept        312282..312530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97839"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97839.1"
FT                   /translation="MTINDVAITYEVCEHEGFKYEMNTYHLNPTIPLDKQLKILARKDV
FT                   APEVAVVMWENGRQVERTYYFPQYQCRCEGNHEGGTT"
     atgacgatca acgacgtggc gattacatat gaagtgtgtg aacatgaggg ctttaagtat        60
     gagatgaata cgtaccatct gaacccgacg attccccttg ataagcagct caagatcctt       120
     gcaagaaaag acgtggctcc tgaggtggca gttgtgatgt gggaaaacgg caggcaggtg       180
     gaacggacgt attattttcc gcagtatcag tgcaggtgtg aggggaatca tgaaggaggc       240
     acgacatga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page