(data stored in ACNUC7421 zone)

EMBL: CP001791.PE289

CP001791.PE289       Location/Qualifiers
FT   CDS_pept        complement(313547..314089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0301"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: hch:HCH_05422 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97841"
FT                   /db_xref="GOA:D6XWJ9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWJ9"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADH97841.1"
FT                   /translation="MPQTRNVTLFIAMSLDGCIATSDHSLDWLEQVEGEGDNGYEKFYS
FT                   TVDTVLLGRKTYDWIRQLALPAFPYEGKSAFVFSRDHHPENDDVHWINEDPVSFVRSLK
FT                   ASDGGTIWLVGGGELVKTLYEAGLIDSYIITIAPVLLGNGIPLFLTNSRHQELELLNSE
FT                   RYGQFIQLYYKRKTRPD"
     atgccacaaa ccagaaacgt gaccctcttt atcgccatga gcctcgacgg ctgcatcgcc        60
     acatccgacc actcgcttga ttggctcgaa caggtcgaag gagaaggcga caacggctat       120
     gagaagtttt acagcaccgt cgataccgtc ctgctcggca ggaagacata cgattggatc       180
     cggcaattgg cgcttcccgc cttcccctat gaagggaaat ccgcttttgt cttctcaagg       240
     gaccatcacc ccgaaaacga tgacgttcac tggatcaatg aagatcctgt ttcctttgtc       300
     cgcagcctga aggcatctga cggcggcaca atctggcttg tcggaggcgg cgaacttgtg       360
     aagacgctgt atgaagcggg attgattgat tcgtacatca tcaccatcgc accggtgctt       420
     ctcggaaacg gaataccgct gtttttgacc aacagccgtc atcaggaact cgagctcctc       480
     aattccgaac ggtacggtca gtttattcag ctttattaca agcgaaagac ccggcctgac       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page