(data stored in ACNUC7421 zone)

EMBL: CP001791.PE290

CP001791.PE290       Location/Qualifiers
FT   CDS_pept        complement(314150..314641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0302"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: dds:Ddes_1073 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97842"
FT                   /db_xref="GOA:D6XWK0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK0"
FT                   /inference="similar to AA sequence:KEGG:Ddes_1073"
FT                   /protein_id="ADH97842.1"
FT                   /translation="MTTAFVLDIRHDSVVDGPGLRSVVFFAGCPHHCLGCHNPDSWIRE
FT                   NGSEQPVSAIIDTLLQNPLSDVTLSGGEPFEQAQAAGLIAKACQKAGKDVWVFTGWTLE
FT                   ALLDRDDPATDLLLVNTDTLVDGPYEQNNPDTGPAFRGSTNQRILTGPFRKPHVLFPPL
FT                   "
     atgacgacgg cgtttgtttt ggatatccgc cacgattccg tcgttgacgg acctggactg        60
     aggagcgtcg tcttctttgc cggttgcccg caccactgcc tcggttgcca caatccggac       120
     tcttggatcc gtgaaaacgg ttcggaacaa cccgtctctg ccatcattga tacgctactt       180
     cagaacccgc tcagtgacgt gacgctgagc ggtggtgaac ctttcgaaca ggcacaagcg       240
     gcggggttga tcgcaaaagc atgccaaaaa gccggcaaag acgtctgggt ctttaccggc       300
     tggacacttg aggcgctttt ggatcgggat gatccggcta cggatcttct tttagtcaat       360
     accgacacgc tggtggacgg cccttatgaa caaaacaacc ccgacaccgg ccctgctttt       420
     cgcggaagca cgaaccagcg gatcctcacg ggaccgttca gaaaaccgca cgttttgttc       480
     ccgcccttgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page