(data stored in ACNUC7421 zone)

EMBL: CP001791.PE297

CP001791.PE297       Location/Qualifiers
FT   CDS_pept        321482..322897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0309"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: prw:PsycPRwf_1468 EmrB/QacA family drug
FT                   resistance transporter; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily; PFAM: major facilitator
FT                   superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97849"
FT                   /db_xref="GOA:D6XWK7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK7"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADH97849.1"
FT                   /translation="MPDDVRKFPIVAVLLTGTFVAILNQTLLVTAIPPIMRDLGINANM
FT                   AQWVNTIFMLVNGIMIPITAFLIGKFTTRKLFMTAMSLFALGTLVAGLSPNFETLILGR
FT                   IIQASGAGIMIPLMQTVLFMIFPVEKRGQAMGLVGLVIAFAPAIGPTLSGFIVDQYPWR
FT                   LLFFIVLPIALIDLVVAYFVLKNVTKQTFPTIDIKSIMLSTFGFGGLLFAFSYAGTTGW
FT                   TSWEVLVSTGVGGVTLTWFILRQLRIPEPILEFRVFRYSIFALSNVIGIVVFMSMIGAA
FT                   TILPIYMQDMLGFSAFQSGLMLLPGALLMGLLNPITGRIFDKVGARWLSISGMALLTVM
FT                   TFLFTRLTEDTSFLYMTTVHAFRMMSLAMVMMPITTAGLNQLPERLIPHGTAMNNTLRQ
FT                   VGGSLGTAFLVTVMTVGAAFSSNGRTMNEAMIQGVNFSFWVATFLAFIGFVIAMFVKNP
FT                   PKRQEVEESTNPH"
     atgcccgatg atgtacggaa attccccatt gtcgccgtgc ttctcacggg gacctttgtg        60
     gcgattttga atcagaccct tctggtgacg gccattccgc cgattatgcg ggatcttggc       120
     atcaacgcga acatggccca gtgggtgaat acgatcttca tgctggtgaa cgggattatg       180
     attcccatca ccgcttttct gattggcaaa tttacgacga gaaagctctt tatgacggcg       240
     atgagtctct ttgccttggg gacgcttgtg gcgggtctgt ccccgaactt cgaaacgctc       300
     attttgggac ggatcattca ggcgagtggt gcgggcatca tgattcccct tatgcagacg       360
     gtgctgttta tgattttccc cgtggagaaa cgcgggcagg cgatgggact cgtgggcctt       420
     gtcatcgcat tcgcaccggc aatcggcccg acgctctcag gctttatcgt tgatcagtat       480
     ccgtggcggc tgttgttttt tatcgtgctt ccgattgccc tgattgacct cgtcgtcgcg       540
     tattttgtgc tgaagaacgt gacaaagcag acctttccga cgatcgacat caaatcgatc       600
     atgctctcga cgttcggctt tggcgggctg ctgtttgcct tcagctatgc gggaacaacc       660
     ggatggacga gttgggaagt gctcgtgtcc actggtgtcg gcggtgtgac cctcacctgg       720
     tttattttga ggcagctgcg gattccggag ccgattctcg agtttcgggt gtttcgctat       780
     tcgatttttg cgttaagcaa cgtcatcggg atcgttgtct tcatgtcgat gatcggagcg       840
     gcgacgattt tgccgattta catgcaggat atgcttggat tctccgcctt tcagtccggg       900
     ctcatgctct tgcccggtgc actgttaatg ggcctcttaa acccgattac agggcgcatc       960
     ttcgacaagg tcggggcgcg ctggctctcg atatcgggaa tggcgctctt gacggtgatg      1020
     acgtttctgt ttacgcgtct tacggaggac acgtcgtttc tctatatgac aacggtccat      1080
     gcctttcgca tgatgagtct tgccatggta atgatgccga ttacaacagc gggcctaaat      1140
     cagctccctg aacgcctcat tccgcacggg acggcgatga ataacacgct ccgacaggtc      1200
     ggcggctccc ttggaacggc tttccttgtc acggtgatga ccgtcggtgc cgccttttcc      1260
     tccaacgggc ggacgatgaa cgaggcgatg atccagggcg tgaacttctc cttctgggtt      1320
     gccacattcc ttgcctttat cggctttgtg atcgcgatgt ttgtgaagaa tccgcctaag      1380
     cggcaagagg tggaggagtc aacgaacccc cactga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page