(data stored in ACNUC7421 zone)

EMBL: CP001791.PE298

CP001791.PE298       Location/Qualifiers
FT   CDS_pept        322966..323160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97850"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97850.1"
FT                   /translation="MILLKSLFLVGTGDVLSFSHLHHPSEEEQFFLSEETTTQYITGVC
FT                   YKPPLQTDREVVKWWVVDA"
     atgattcttc tcaaatcact gtttttggtt ggtactggcg acgtactatc gttttcccac        60
     ttgcaccacc cttccgaaga agagcagttc ttcctttcgg aagaaaccac cactcagtat       120
     ataactggcg tgtgctacaa gcccccactt caaacagacc gcgaggtcgt taagtggtgg       180
     gtcgttgacg cttaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page