(data stored in ACNUC7421 zone)

EMBL: CP001791.PE299

CP001791.PE299       Location/Qualifiers
FT   CDS_pept        323353..323703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0311"
FT                   /product="HicB family protein"
FT                   /note="PFAM: HicB family protein; protein of unknown
FT                   function UPF0150; KEGG: pca:Pcar_0789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97851"
FT                   /db_xref="GOA:D6XWK9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWK9"
FT                   /inference="protein motif:PFAM:PF05534"
FT                   /protein_id="ADH97851.1"
FT                   /translation="MKKEVRDILNKPYHIVTNAVRDEVGHYYVARVLEFDGCIATGETQ
FT                   EEAHQMVNEVMESYIEDMLEDGDAIPEPVGDDHFSGNVRLRMPKSLHRDLSRAAKLEGV
FT                   SLNQYLISKLSK"
     gtgaaaaaag aagtcagaga tattctgaac aagccttatc atatcgtaac gaacgcggtt        60
     cgtgatgagg tgggtcacta ttatgtggcc agagtattgg aattcgacgg atgcatagct       120
     acaggagaga cgcaagaaga agcgcatcag atggtcaatg aagtgatgga aagttatatc       180
     gaagacatgc ttgaggatgg agatgcgatt ccggagccgg ttggggatga tcatttcagt       240
     ggtaacgtca ggcttcgcat gccgaagagt ctccacaggg atttaagtcg tgccgcaaaa       300
     ttggaagggg tctcattaaa tcaatacctg atctccaaat tgagtaaatg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page