(data stored in ACNUC7421 zone)

EMBL: CP001791.PE30

CP001791.PE30        Location/Qualifiers
FT   CDS_pept        complement(42673..43281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97582"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97582.1"
FT                   /translation="MLRSLFVSLPAAFLITLSACGTEADQNRGNEQPERDIDHVSGEAA
FT                   HMERGQETNNGAERNDETAPVSFTEQEAISLLHDYEETLQAFFEEAQAHGQTLESVGEI
FT                   GEVENELTRILSAEGADMHLNTYFREEDGTVTVIPTEAPVWFDETAPYTFYDNEQGSPR
FT                   LEQERENELIGHVRMIYSFSYDDRQETWRISDIDSEPMS"
     atgcttcggt cactgttcgt cagtcttcct gcggcctttt tgatcacgct ttccgcatgc        60
     ggtacggaag cggatcaaaa ccgggggaat gaacagcccg aacgggatat tgatcacgtt       120
     tccggtgaag ctgcacacat ggaaagaggt caggagacaa acaacggggc cgaacgtaac       180
     gatgaaacag cccccgtttc gttcactgaa caggaggcca tctcacttct gcacgactat       240
     gaagagacgc tgcaggcttt ctttgaagaa gcgcaggcac acggtcagac cctggaatcc       300
     gtcggggaaa tcggtgaggt ggagaatgag ctgacgagga ttttaagcgc ggagggagcg       360
     gacatgcacc tgaacacgta tttccgcgaa gaggatggca cggttaccgt catcccgact       420
     gaagcaccgg tctggtttga tgagacggct ccgtatacct tttacgacaa tgagcagggg       480
     tcgccccgcc tcgaacagga gcgtgagaat gaactgatcg gtcatgtacg gatgatctac       540
     agcttttcct acgatgatcg tcaggagaca tggcgcattt cagacatcga ttctgagccc       600
     atgtcctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page