(data stored in ACNUC7421 zone)

EMBL: CP001791.PE301

CP001791.PE301       Location/Qualifiers
FT   CDS_pept        324228..324986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0313"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   smd:Smed_2597 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97853"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADH97853.1"
FT                   /translation="MHIQLIRNATVIIQIAGKRLLVDPMLSPKGTMPGFRNSPREEEGN
FT                   PLVELPVPIEEIVEIDAVIVTHLHADHWDQAAVDHLPKDVSLFCQNEEDQRAIKNQGFR
FT                   DVRVLRPETKWAGIQLTVTPAQHGRGEILNHLGHVSGVVLKHPSEPVTYLTGDTVWYEG
FT                   VAETIRRHEPDVIVVNGGDNQFHTGGSLVMGKKDILDVHKASPASDLVAVHMEAVNHWT
FT                   LSRMELRRFSEEEGMAERLWIPDDGESRSY"
     atgcatattc aactgatccg aaatgccact gtgatcatac agatcgcagg gaaaaggctg        60
     ctcgttgacc cgatgctgtc acctaaaggc acgatgcccg gttttcgaaa cagtccgaga       120
     gaagaagaag gaaatcccct cgttgagttg cctgttccga ttgaggagat tgttgaaatc       180
     gatgcggtga ttgtgacaca tctccatgcg gatcactggg atcaggctgc ggtggatcat       240
     ttgccgaaag acgtgtcgct cttttgtcag aatgaagagg atcagcgggc gatcaagaac       300
     cagggcttcc gggatgtccg ggtgctgagg ccggagacga agtgggcagg gatacagctt       360
     accgtgaccc cggcccaaca cggaagagga gaaatactga atcacctcgg tcacgtctca       420
     ggtgttgtgc tcaagcaccc gtcggaaccg gtgacgtatc ttacgggaga cacggtctgg       480
     tatgagggtg tcgcggagac gattcgccgt cacgagccgg atgtgatcgt cgtgaacggc       540
     ggggacaatc agtttcacac aggcgggtcg ctcgtgatgg gcaaaaaaga tatcttagac       600
     gtgcacaagg cttcgccggc gagtgatctt gtcgctgttc atatggaagc ggtgaatcac       660
     tggacgctct cacgcatgga gcttcgccgg ttttccgaag aggagggaat ggcggagcgt       720
     ttatggattc cggacgacgg cgagtcccgg tcctattga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page