(data stored in ACNUC7421 zone)

EMBL: CP001791.PE303

CP001791.PE303       Location/Qualifiers
FT   CDS_pept        325580..325822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0315"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: tbd:Tbd_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97855"
FT                   /db_xref="GOA:D6XWL3"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL3"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADH97855.1"
FT                   /translation="MHGYNTGNFLMGGGWIWGLFQLALVILIVYVVWQLIQNRRGSSSQ
FT                   EDARQDALSILDSRFASGEIDDDEYNRKKRAILDR"
     atgcatggtt ataataccgg gaacttcctg atgggaggag gatggatctg ggggctgttt        60
     cagctggccc tcgtgatcct catcgtctat gtggtctggc agctgataca gaacagacgg       120
     ggctcctctt cccaggaaga tgcgaggcag gatgccctgt cgatcctcga cagccgcttc       180
     gcctcaggtg aaatcgatga tgacgaatat aatcggaaaa agcgggcgat tttggatcgc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page