(data stored in ACNUC7421 zone)

EMBL: CP001791.PE304

CP001791.PE304       Location/Qualifiers
FT   CDS_pept        325898..326143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0316"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: tbd:Tbd_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97856"
FT                   /db_xref="GOA:D6XWL4"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWL4"
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /protein_id="ADH97856.1"
FT                   /translation="MHMMGGGGPGGFWWMPVMMGVYVLILIILAVVLIRSFTKGSGKGK
FT                   SAIDILNEQLARGEISEEDYDRLKAKILDSERRDRQ"
     atgcatatga tgggaggcgg aggaccgggc ggcttctggt ggatgccggt gatgatgggc        60
     gtgtacgttc tgatcctgat cattttggcc gtcgtcttaa tccgctcgtt tacgaaaggt       120
     tcaggtaagg gaaaatcggc gattgatatt ctcaacgaac agctcgcaag aggcgagatc       180
     agtgaagagg attacgaccg tctgaaggcc aaaatcctcg acagtgaaag gcgggatcgg       240
     caatga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page