(data stored in ACNUC7421 zone)

EMBL: CP001791.PE310

CP001791.PE310       Location/Qualifiers
FT   CDS_pept        331117..331737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0322"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97862"
FT                   /db_xref="GOA:D6XWM0"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM0"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97862.1"
FT                   /translation="MNKIQQLSEGIFRYALLNLMWVGYSLLGFIVFGILPATIALFKVH
FT                   FHQHRNRLEPERESDVRVFHEAYKSSFIRGNLLMLILTAAGVFLYADLYIVLRMDHALM
FT                   PILLGLIVALTVLYLLFLFFVPASFAYENRPFFETIRAGFYMAVLSPIYSISLVIAFGI
FT                   IIYAGQIVPAIHLFFTASVMTYLVTAVFLLKADRLRRMAGKNN"
     atgaacaaaa tccagcagct cagtgaaggg atctttcgct acgccttgtt aaacctgatg        60
     tgggtcgggt attctcttct cggtttcatc gtgttcggga ttttgccggc taccattgcc       120
     ctttttaagg tgcatttcca ccagcaccgg aatcgccttg agcctgaaag ggaatcggat       180
     gtccgggtgt ttcatgaggc atataaatca tcttttatca gaggcaatct cttaatgctg       240
     atactcacgg ccgcaggagt cttcctctac gcggatctgt acattgttct gaggatggat       300
     catgcgctca tgccaatcct gctcggcctg attgtggcac tgacagtatt gtatctgctg       360
     tttctgtttt tcgtgccggc gtcgtttgct tacgaaaacc ggccgttttt tgaaacgatc       420
     cgtgcggggt tctatatggc tgttctttca ccgatctact ccatttcgct ggtgatcgcc       480
     ttcggaatta tcatttatgc aggtcaaatt gtccctgcaa tccacttatt tttcacggcc       540
     agtgtcatga cataccttgt cacagcagtg tttctgctga aggcggacag gctcagacgc       600
     atggctggaa aaaataatta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page