(data stored in ACNUC7421 zone)

EMBL: CP001791.PE311

CP001791.PE311       Location/Qualifiers
FT   CDS_pept        331955..333301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0323"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: vsp:VS_II1391 ABC transporter: substrate-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97863"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97863.1"
FT                   /translation="MKKYLYLTSIIGMSAMLAACGGNDEGNNGNADPDPDNANSPSADN
FT                   ENDDTEVSDVGSDDADVELSVWLFGATGYPELAEEYAEENPNVSISFQEIEMGDHHNNL
FT                   FTALSAGSGAPDLALIEVSEMDGYKSAEDRFVNLFDMGAGDLEDDYLDWAWENAQNVDG
FT                   DFLFGLPTDVGPTAMFYRADVFEEAGLPSDPEELEAMLQTWEDYEEAAATIMEETGKPI
FT                   SGNPETLYNALRDQAPQSYFNEDNELILETTDYVRNAFMRTSDMINNDFVENLGMWTPE
FT                   WGSGMADGSFAAMMAPAWMQGVIQDNAPDATEWRIIQVPEGGGNWGGSYMTMPDQTEHP
FT                   EEAYAFMEWLLAPEQQLKAFENMGLFPSAPSVYEMDEFQNFTSDYFGGQATAQVFAQSA
FT                   LDGEHVYQGPSYGDVNSEILSGLDNVYDGIDPEEEWEDVLNRVNQRINR"
     atgaaaaagt atttgtattt aacaagcatc atcgggatgt cagctatgct cgcagcgtgc        60
     ggcggcaatg acgaaggaaa taacggcaat gcagatccgg atccggacaa tgcaaacagc       120
     ccaagcgcag acaacgagaa tgatgacacg gaagtttctg atgtcggctc agacgatgca       180
     gacgtggaac tgagtgtctg gctcttcggt gctactggct acccggaatt ggctgaagaa       240
     tacgcggaag aaaatccgaa tgtcagcatc agtttccagg aaatcgaaat gggtgaccac       300
     cacaacaacc tgttcactgc actttcagca ggaagcggcg cacctgacct tgcattgatc       360
     gaagtatctg aaatggatgg ctacaaatcc gctgaagatc gtttcgtcaa cctgtttgac       420
     atgggtgcgg gagaccttga agatgactat cttgactggg catgggaaaa tgcacagaac       480
     gtcgatggag acttcctctt cggtcttccg actgacgtag gcccaacggc tatgttctac       540
     cgtgctgacg tattcgaaga agctggcctt ccatctgatc cggaagaatt agaagcaatg       600
     cttcagacgt gggaagatta cgaagaagca gctgcaacaa tcatggaaga aacaggtaag       660
     ccgatttccg gaaacccgga aacgttatac aacgcacttc gtgaccaggc tccacagtct       720
     tacttcaatg aagacaatga gctgatcctt gaaacaacag actacgttcg taacgcattc       780
     atgcgtacgt ccgacatgat caacaatgac ttcgttgaaa atctcggcat gtggacacct       840
     gaatggggat ccggcatggc tgacggcagc tttgctgcaa tgatggcacc ggcttggatg       900
     cagggtgtta ttcaggataa cgcgcctgac gcaacggagt ggagaattat ccaggttcct       960
     gaaggtggcg gaaactgggg cggttcttat atgactatgc ctgaccagac agagcaccct      1020
     gaagaagcat atgcattcat ggagtggctc cttgctccag aacaacagtt aaaggcgttt      1080
     gaaaacatgg gtctcttccc atctgcacct tctgtgtatg aaatggatga attccaaaac      1140
     ttcacaagtg actacttcgg tggccaggca acggctcagg tctttgcaca gtctgcactt      1200
     gacggtgagc acgtttacca gggaccaagc tatggtgatg tgaacagtga aatcctgtcc      1260
     ggtttggata acgtttatga cggtatcgac ccagaagaag agtgggaaga tgttcttaac      1320
     cgtgtgaatc agcgtattaa ccgataa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page