(data stored in ACNUC7421 zone)

EMBL: CP001791.PE312

CP001791.PE312       Location/Qualifiers
FT   CDS_pept        333466..334443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0324"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hch:HCH_06909 ABC-type
FT                   sugar transport system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97864"
FT                   /db_xref="GOA:D6XWM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97864.1"
FT                   /translation="MSDSNETSNKLNQTEPAAPKEPKRRKFSQRQKNMASGYLFISPFY
FT                   FLFAVFGLFPILFSFYLAFFRWDGLGPMEYVGFRNFEIIFNDPLFWKSLYNTIIIGLMG
FT                   TAPQLIAALLLAFALNSVLVKAKSAFRLAIFLPYVTSIVAVAIVFSVIFSNQASGLVNS
FT                   FIGLFGADPVTWSRSEWGTKFAIATMIFWRWVGYNMIIYLAGMQSIPNDLYEAAKIDGA
FT                   TVRQQIWYVTIPMLKPFIIFTVFTATIGALQVFAEPHIFQGRAGRTEGITVVLYLYRDA
FT                   FVSNFFGTASATAIVLFFIIIVMSISNMYFANRIGQSKKVGVKQ"
     atgtctgatt ccaatgaaac atcaaacaaa ttgaaccaga cagaaccggc ggctccgaaa        60
     gagccgaagc ggagaaagtt ttcgcagcgt cagaagaata tggcgtccgg ctatctgttt       120
     atctcgccat tttactttct gtttgcggtt tttgggcttt tcccgatttt attcagtttt       180
     tatctcgcat ttttccgctg ggacggtctt ggcccgatgg agtatgtcgg attcagaaac       240
     tttgagatca tttttaatga tccgctgttt tggaagtccc tgtacaatac gatcatcatc       300
     ggtctgatgg gaacggctcc gcagctgatt gcagcactgc tgctcgcttt tgcactgaac       360
     tctgttctgg ttaaagcgaa gagtgctttc cgtcttgcga ttttcttgcc gtatgtcacg       420
     tcgatcgttg ccgtggccat cgtattcagt gtcatcttca gtaaccaggc atccggtctt       480
     gtcaactcat tcatcggcct gtttggtgca gatccggtca cgtggtcacg ttccgaatgg       540
     gggacgaagt tcgctattgc gacgatgatc ttctggcgtt gggtcgggta taacatgatt       600
     atttatcttg ccgggatgca gagtattccg aacgacctgt atgaagcggc caaaatcgac       660
     ggcgcaactg tacggcagca aatctggtat gtcacgatcc caatgctgaa gccgttcatt       720
     atcttcacgg tcttcactgc gacaatcggg gcgcttcaag tctttgccga gccgcatatc       780
     ttccagggga gagcgggacg gaccgagggg attaccgtgg tactctacct ctaccgtgac       840
     gccttcgtga gtaacttctt tggaacggca tctgcaacgg ccatcgtgct cttctttatc       900
     attatcgtca tgtccatttc gaacatgtac tttgcgaacc gaattggtca gtcgaagaag       960
     gtaggtgtga aacaatga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page