(data stored in ACNUC7421 zone)

EMBL: CP001791.PE313

CP001791.PE313       Location/Qualifiers
FT   CDS_pept        334440..335279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0325"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rfr:Rfer_1101
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97865"
FT                   /db_xref="GOA:D6XWM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97865.1"
FT                   /translation="MKSEKQKTLISKILLYIGLSIVSLASLFPFYWMFVMATNSNEMIN
FT                   RTPPVMVPGDRLVDNFQNVLNSIPFFQTMLNSLIAATSITLGVLLLTSIAGFAFAKLEF
FT                   PARNILFFFILGTMMIPPQLGLIPTYFIITELGWLSDLRAVIVPGLMNAFGIFWMRQYV
FT                   ASAVPDEIIEAARIDGCSNFRIYWNIVVPVILPAFATLGIIVFMFVWGDYLWPLVVLQD
FT                   QSSQTIQVALRSLMDDRSRDYGMILSGTFWATVPLVVVFLFFNKLFIRSIADGAVKS"
     atgaagtcag aaaaacaaaa gacactaatc agtaaaatcc ttctgtatat cgggttatcc        60
     attgtttccc ttgcctcgct atttccattc tactggatgt ttgtcatggc aacgaactca       120
     aacgaaatga ttaaccggac accgccggtc atggttcctg gtgacaggct cgtcgataac       180
     tttcaaaacg tattgaacag tattccattc tttcagacca tgttgaactc tctgatcgca       240
     gcgacatcga tcacccttgg ggtgctcctg ttaacctcga tcgccggttt tgccttcgcg       300
     aagcttgaat tccctgcgcg aaacatcctg ttcttcttta ttctcggaac gatgatgatt       360
     ccgccgcagc tcggtcttat tccaacgtac ttcatcatca cggaactcgg ctggctgagt       420
     gacctgcgtg ctgttattgt accgggtctg atgaacgcct tcgggatctt ctggatgaga       480
     cagtacgtcg cgagtgccgt gcctgatgag atcatcgaag ccgcccgtat tgacggctgt       540
     tctaacttcc gtatctactg gaacattgtt gtaccggtta ttttgccggc cttcgcaaca       600
     ctcgggatca tcgtcttcat gttcgtatgg ggtgactacc tctggccgct cgttgtgctt       660
     caggatcagt ccagccagac gattcaggtt gcacttcgtt ccctcatgga tgaccgaagc       720
     cgtgactacg gtatgattct gtccggtaca ttctgggcta ccgtgccgct cgtcgtggta       780
     ttcctgttct tcaacaagct cttcatccga agtatcgcag acggtgcggt caagagctaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page