(data stored in ACNUC7421 zone)

EMBL: CP001791.PE315

CP001791.PE315       Location/Qualifiers
FT   CDS_pept        338726..339541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0327"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rlt:Rleg2_6440 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97867"
FT                   /db_xref="GOA:D6XWM5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH97867.1"
FT                   /translation="MDPFEQYYIQIEGREDATHTLVFAHGFGCDQQVWNLVSPAFEDEY
FT                   LIVRFDYTGAGRSAKSAYSSEKYRTLDGYAEDLKAVIHAAGGERITVVAHSVSGMIAAQ
FT                   AIIDEPGLFDDLIMIGPSAHYLNHPDYHGGFDREDIDGLLHMMEQNYKEWARYLAPIVM
FT                   KNEDRPELAEDFSNQLCSNDAAIIREFAEATFLSDHRDILEAVNVPVLVIQPADDTIVP
FT                   VEATTYLVRELPDARIVWMNGRGHNPHLSHPEELIPLIEEWTGRDGVRE"
     atggatcctt ttgaacagta ttatatccag atcgagggca gagaggacgc aactcatacg        60
     ctcgtgtttg ctcacggctt cggctgtgat cagcaggtat ggaatcttgt cagcccggcg       120
     ttcgaggacg agtaccttat cgtgcgtttt gattatacag gggcaggccg ttcggcaaag       180
     tctgcataca gctcggaaaa ataccggacc cttgacggtt acgcagagga tttaaaagcg       240
     gtgatccatg ccgcgggtgg tgaacggatc accgttgtgg cgcattccgt cagcggcatg       300
     atcgccgccc aggcgatcat cgatgaaccg ggtctgtttg atgatttgat catgatcggt       360
     ccgtccgcgc attacctgaa tcatccggac tatcacggtg gttttgaccg cgaagatatt       420
     gatgggctgc ttcatatgat ggaacagaat tataaagaat gggcccgtta cctggcaccg       480
     atcgtgatga agaatgaaga ccgtccggaa ctcgccgagg atttctccaa tcagctttgc       540
     agtaatgacg ccgcaattat ccgcgaattt gcggaagcga cgtttctttc ggatcaccgg       600
     gacattctcg aagcggtcaa cgtgccggtt ctggtcattc agcctgccga tgacacgatc       660
     gtgccggtgg aggcgacgac ctatctcgta agggaactgc ctgatgcccg gattgtctgg       720
     atgaacggtc gcggtcataa cccgcacctc agtcatccgg aagaactgat ccctctgata       780
     gaagaatgga cagggcgaga cggggtgcgt gaatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page