(data stored in ACNUC7421 zone)

EMBL: CP001791.PE318

CP001791.PE318       Location/Qualifiers
FT   CDS_pept        complement(342740..343102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0330"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: dde:Dde_0747 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97870"
FT                   /db_xref="GOA:D6XWM8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWM8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADH97870.1"
FT                   /translation="MKTTDTCDIFTYDSERVESTSAMIQNRDLDGAARIFKVLGDRNRT
FT                   AITYALCENDTLCVCDIATIIDASVATTSHHLRTLYKEGVVTYEKKGKLAMYALDDNHI
FT                   RQLMMTTLEHAEERKD"
     gtgaaaacaa cggacacatg cgacattttt acctatgaca gcgagcgggt cgaatcaacc        60
     agcgccatga ttcagaaccg ggatctcgac ggcgccgcca ggatcttcaa agtcctcggc       120
     gaccggaacc ggacagccat cacctatgca ctctgtgaga acgacaccct ctgcgtctgc       180
     gatatcgcca ccataattga cgcgagcgtc gcgacgactt cccatcattt gaggacactg       240
     tataaagagg gcgtggtcac ctacgaaaaa aaggggaagc tcgccatgta cgcccttgat       300
     gacaaccaca tccgccagct tatgatgaca acactcgaac atgcagaaga aaggaaggat       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page