(data stored in ACNUC7421 zone)

EMBL: CP001791.PE322

CP001791.PE322       Location/Qualifiers
FT   CDS_pept        complement(346091..347128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0334"
FT                   /product="Arabinan endo-1,5-alpha-L-arabinosidase"
FT                   /EC_number="3.2.1.99"
FT                   /note="KEGG: scl:sce1485 putative Beta-xylosidase; PFAM:
FT                   glycoside hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97874"
FT                   /db_xref="GOA:D6XWN2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN2"
FT                   /inference="protein motif:PRIAM:3.2.1.99"
FT                   /protein_id="ADH97874.1"
FT                   /translation="MGIYQLSFRGFTVALLSATWLLAACTTDTPGGDVAGGIEMSGDIG
FT                   DYNPEEGVDDPVHDPAVLKSEDEYVLFSTGIERDPSDPGGIFMRKSADNLGGPWESIGE
FT                   IPVPEWIDPFEPNHLWAPMAIKQDERCFLYFSVSSFGSNRSAIGVASSSSPLDPASWED
FT                   HGILIESGAGTSFNAIDPHVFEYEGQLWLTFGSHFSGIHIIEMESPTQINSAMNPQLLQ
FT                   SRPGVPHNPVEAPSIIERNGYFYLFTSWDQCCSGLDSTYKIAVGRSDKPEGPYFDQEGE
FT                   PLVQGGGTILLEEEGNQIGPGGQDVYSEDGTDYLIHHYYDADADGVIRFQIRELSWEDD
FT                   WPTLE"
     atggggattt atcaattaag tttcagggga tttacagtag cgctcctctc agcaacatgg        60
     ctgcttgctg cctgcaccac agatacacca gggggtgatg tcgctggcgg gatagagatg       120
     agcggcgaca ttggagatta taatccagag gaaggggtcg atgatcctgt tcacgacccc       180
     gctgtattaa agtcagaaga tgaatatgtg cttttctcaa cagggattga aagagacccc       240
     tccgaccccg gcggtatttt catgaggaaa tctgccgaca acctcggagg gccatgggaa       300
     tccattggcg aaatacctgt tcctgaatgg atcgatcctt tcgaacccaa tcatctttgg       360
     gctcccatgg cgatcaaaca agatgaacgg tgcttcttat acttttccgt atcctctttc       420
     ggctctaaca gatctgccat aggtgtcgct tcatcatcat ctcctttgga tcctgcgtct       480
     tgggaagatc atggaattct cattgaatcc ggagctggta ccagctttaa tgcaattgat       540
     ccccatgtgt tcgagtacga aggacaatta tggcttacat tcggatctca tttctccggc       600
     attcacatca tagagatgga atctcccaca caaatcaata gcgcgatgaa tccccagttg       660
     ctgcagtcca gacctggagt tccacataat cctgtagaag ctccgtcaat cattgagcga       720
     aacggttatt tttatctgtt tacctcatgg gaccaatgtt gcagtggcct cgacagtact       780
     tataaaatag ccgtcggacg gtccgataaa ccggaaggcc cctattttga tcaagagggt       840
     gaacctttag tccagggcgg tggtacaatt ctccttgaag aagaaggaaa tcaaatcgga       900
     cccgggggac aagatgtata ctcagaagac ggaacagact acctcattca ccactactat       960
     gatgctgacg cagatggcgt gatccggttt cagatccggg aactgtcgtg ggaggatgat      1020
     tggccaacac tggaataa                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page